KEGG   Trichoplax adhaerens (placozoan): TRIADDRAFT_56202
Entry
TRIADDRAFT_56202  CDS       T01069                                 
Name
(RefSeq) hypothetical protein
Organism
tad  Trichoplax adhaerens (placozoan)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 6753524
NCBI-ProteinID: XP_002112311
JGI: 56202
UniProt: B3RXG7
AA seq 531 aa
MEIQSKHDCKLPEDLNLVDFIFEYFDKYGDREAVVDAASGRCYTYAQIRGLARKFASALT
RRGLQKGDTVAVYSPNIPEYPIVFFGIIIAGGTITTCNPLYTPKELSHQLHLAEAKHIFT
VNLFAEKAKEAAFLSKISNIYVLGSPTGDGITSFQELLADDGSYLKEVKFDVREDVAVLP
FSSGTTGLPKGVMLTHHNIVSNVSQATIKGFFYVNTDDTILALLPWFHIYGMVTILFAGL
RFGAKIISMARFEPKAFLETIQKHKITIAPIVPPIAVFLSKHPLVDSFDVSSLKDVISAA
APLGKETQAALGTRLGVNVRQGYGMTELSPVITVSISEGNVIGSAGVLIPHTKAKTVDIQ
TGEALSYGKSGELCFKGPQVMKGYLKNKAATDRTIDADGWLHTGDIGYYDESGHFYIVDR
LKELIKYKGFQVAPAELEELLLTHPKVADAAVIGVPDVDAGELPKAFVVKRANDITEEEI
IAFIASEVGPHKKLRGGVEFIESIPKSASGKILRRQLKAQEIEKCEKDKSS
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggagatacaaagtaaacatgactgtaagttaccagaggatcttaatctggtggatttc
atctttgaatattttgataaatacggcgatagagaggccgtggtcgatgctgccagtggc
cgatgctatacttatgcacaaattcgaggattagctcgtaaatttgcttctgctttaact
cgccgtggtctacagaagggcgatactgttgccgtctactcacctaatattcctgaatat
ccaatcgtcttctttggtattataatagctggtggtactattactacttgcaatccgtta
tacactcctaaagagttatctcatcaattgcatcttgctgaagcaaagcacatttttact
gttaatctgtttgctgaaaaagccaaggaggcagcatttctaagcaaaatttctaacatt
tacgtccttggaagtccaactggtgacggtataacatcttttcaagaattactagctgac
gatggtagctatctgaaagaagttaagttcgacgttcgtgaagatgtggctgtattacca
ttttcgagtggtacgacaggattgccaaaaggcgtaatgctaacgcatcacaatattgtc
agtaacgtcagtcaagcaacgattaagggcttcttttacgtgaatactgatgatacaata
ttggctttattaccatggttccatatttatggtatggtaactattctatttgctggattg
cgctttggcgctaaaataatttccatggcaagattcgagccaaaagcgtttcttgagact
attcagaagcataagattactatagctccaatagtaccacctatcgctgtatttctgtcg
aaacatccactagtagacagcttcgacgtttccagtttaaaagatgttataagtgcagct
gcacctttgggtaaggaaactcaagctgcgctggggacaagattaggagtaaatgttcgg
caaggttatggtatgactgagttaagtccagttattaccgtatctatttcggaaggaaat
gtgattggttcagccggagtattgattccacataccaaagctaagaccgtagatattcaa
actggtgaggccttatcttatggaaaatcgggagagttatgcttcaaaggaccgcaggtc
atgaagggctatttgaaaaacaaagcagcaacagatagaaccatcgatgcagatgggtgg
cttcatactggagatattggttattatgatgagagcggacacttttatatcgtggatcgt
ctgaaagaattgattaaatataaaggatttcaggttgcgcctgctgagttagaagagttg
cttttgactcatcctaaagttgctgatgctgcagttattggtgttcctgatgttgatgct
ggtgaattaccaaaagctttcgtggtaaagcgagcaaatgatattactgaggaagaaatt
attgcttttattgcatcagaagtcggtcctcataaaaaactacgtggaggagtagaattt
atcgaaagtattcctaaatcggctagtggtaaaattttgcgacggcagttgaaagctcaa
gaaattgaaaaatgtgaaaaggataaatcaagttga

DBGET integrated database retrieval system