KEGG   Trichoplax adhaerens: TRIADDRAFT_56525Help
Entry
TRIADDRAFT_56525  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
tad  Trichoplax adhaerens
Pathway
tad00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRIADDRAFT_56525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tad01007]
    TRIADDRAFT_56525
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tad03016]
    TRIADDRAFT_56525
   03029 Mitochondrial biogenesis [BR:tad03029]
    TRIADDRAFT_56525
Enzymes [BR:tad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     TRIADDRAFT_56525
Amino acid related enzymes [BR:tad01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TRIADDRAFT_56525
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TRIADDRAFT_56525
 Prokaryotic Type
   Other AARSs
    TRIADDRAFT_56525
Mitochondrial biogenesis [BR:tad03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TRIADDRAFT_56525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1
Motif
Other DBs
NCBI-GeneID: 6754125
NCBI-ProteinID: XP_002112472
JGI: 56525
UniProt: B3RYE0
AA seq 519 aa AA seqDB search
MTANFRLYIANQVAQLLQQEVNLISNQIRVTGRNYKSFGFILPVNNVLTNQLPKGANTFR
HSCQTAQNLAQQVQIDNHYIHNVTVDKASIIFQPNHQTLMTEVLNNAMNNNAVTDYSNET
KKHILVDYSSPNIAKPFHVGHLRSTFIGNFIANINEYFGNKVTRINYLGDWGVQFGLLGV
GFQKFGSTESLINNAIKHLFDVYVQINNEMERDASIQERARLFARRMEEDDEECINLWKQ
FRSLSIKEYKKIYKDIIEKLRDDGLLVDNRDIVAAIDRFERFNFDEMYYVTSSAQNLHFQ
HLFKILNLSGYNWVKNCYHVDFGMVKGMSTRTGNVVFLQDILDDAKERMMKTLSRKHNDP
SSIAELVGLAAILIQDLKAKRIKDYEFNWEKMLASHGDTGPRLQYEHARLVSIAEKTQVP
INMEADITSLLSENSAIKLVEHITRFEGELVRAKLHSEPCFLVNYLFILSHLISAANHNL
KVLGQTEKIAEARMLLFAASRNTLAKGLNILGVKPLNKM
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaattttcgcctgtatattgctaatcaagtagctcaattattacaacaggaa
gtcaatctcattagcaatcaaatacgagttacaggacgcaactacaaatcgtttggattt
attcttcccgtaaataatgttcttaccaatcaattacccaagggagctaatacattccga
cacagctgccaaacagctcaaaatctggctcaacaggtacaaattgataatcattatatc
cataacgtcaccgttgataaagcatccatcatctttcaacccaatcatcaaacattgatg
acggaagtactgaacaatgcaatgaataacaacgctgtgaccgactactctaatgaaact
aaaaaacatattttagtggattacagttctcccaatattgctaaacctttccatgtcggt
catttaagatcaacctttattggtaactttattgccaatattaacgaatacttcgggaat
aaagtaacaagaataaattatttaggagattggggtgttcagtttggattattaggtgtt
ggttttcaaaaatttggttctacggaatccttaatcaataatgccatcaaacatttattt
gatgtttacgttcagatcaacaatgagatggaacgagatgctagcattcaagaacgggca
agattatttgcaagacgtatggaagaagatgacgaagaatgcattaatctgtggaaacaa
tttcgtagtttgagcattaaagaatacaaaaagatttacaaggacattatcgaaaaacta
cgagatgatggattacttgtagacaatagagatattgtggcagcaatagaccgttttgaa
aggttcaactttgatgagatgtactatgtgacttcaagtgcccaaaacctacattttcag
catttatttaaaattctcaacttaagtggttacaattgggtcaaaaattgttaccatgtc
gattttggcatggtgaaaggtatgagtacgcggacaggaaatgtggtatttctgcaggat
attctggatgatgcaaaagagagaatgatgaaaaccttatctagaaaacacaatgatcct
tcaagtattgccgaactagttggtttggctgctattttaattcaggatctgaaagctaaa
agaattaaagattacgaatttaattgggagaagatgctagcttcacatggtgatactggc
cctcgtttgcaatatgaacatgcccgtcttgttagtatcgcagaaaaaactcaagttccg
attaacatggaagcagatataacatctttattatctgaaaattctgcaatcaagctagtg
gaacatatcactaggttcgaaggggaacttgtaagagcaaaattacactcagagccatgc
tttcttgttaattacctcttcatcttaagccatttaatatcagctgcgaatcataattta
aaggtcttaggccaaactgaaaagatagctgaggcaagaatgttgctatttgccgcttca
aggaatactctggctaaaggattgaatatattaggtgtcaaaccgttaaataaaatgtaa

DBGET integrated database retrieval system