KEGG   Trichoplax adhaerens: TRIADDRAFT_57537Help
Entry
TRIADDRAFT_57537  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K11858  ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIADDRAFT_57537
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRIADDRAFT_57537
Ubiquitin system [BR:tad04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    TRIADDRAFT_57537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ubiquitin DUSP Dioxygenase_N
Motif
Other DBs
NCBI-GeneID: 6754620
NCBI-ProteinID: XP_002113407
JGI: 57537
UniProt: B3RZQ3
AA seq 1002 aa AA seqDB search
MKGKQTRSSNKYKIDWEWAKESTVQQINQEQVEKVYGVHFNSCSLTNDKTHSKSNCRSNP
NCLVHLGEANWISNTEVESAVYTEVIENIVRQDNQFLGLRNLGATCYVNSLLQVWFFISD
FRSAIYSYRNDFVRDKVIKVDLLTDKGFSLMGLDDNVDIESHYYEKINISKKISDSIKSS
QAIHSSSQGRRSLLNNLYESVPEFVGNQEQILPALASICDYLQLIFAFLQFSKRRCDSCK
FISERNATFYELDLTVAGHSTLEKSFDDFFKLTTVFEKLRSRLSDNTCGHSYCDITILLQ
KEKLNGPNQYYCEVCQSKRDASRWIGVDSLPPVLNIQLLRFIYDRNTGQKKKLKSILHFP
EVLDMTKYIRHAPTDTSFIYDIKAVLIHRGAGTQSGHYFTHIKEDESKSWYVFNDEAVYQ
LSGKKLQIDEDSMESDDLSQSSKNPKPVKAGYHASRSAYMLVYTRRSSIGEYSSDLKENV
ILPRSIVKIISEDNVSIKNWINAVTEQMLSHTAAISNRAQEINRIYPSLSADTDQTYEWI
PTEWLLEWLRKQDFNSPIDNKTVLCNHKKLSPDSVSMVKRINQIYANELYKLYGGGPRLT
REDMCKQCVEEKYRRIQFDTRLNNDWKFIKSTITKTLPTGQTEFWIGKVSLRNWKGLTIK
KFEKDISESSLKTTTENSEPAKEDAESDANLAADSATYDDEFEFNQDLLCEEHGNLTAEE
SNRQIVSEVVWLMLKYYFPEAASYPVGTPICHLCEEIAKARVEDEETLRLYAATEKKILS
KIYSNKSRPSIEDEGEFYVIPLSFVRKWRNFISYVNVTTEEWVNLLNFYGTTSETCKEIK
ITVKDRLCECFPPCCQICIDSLIERRATEIKTYRNARIYISKENPDDEKCIGPSHDECEN
IQKESRKRSITTISPLRRSKRCRPGEVAVTISSDETLRDLKLKVMTEFQVAPFDQHLHLN
GCELFDNDRTLGNSGILPDCRLTLKIDLPVEITEEPRGQLNG
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaagcaaacgcgtagcagtaacaagtataaaattgattgggaatgggctaaa
gaatccactgtacagcaaattaatcaagagcaagtagaaaaagtttatggagttcatttt
aattcctgcagcttaaccaacgataagactcatagcaagagtaattgtcgcagtaaccca
aattgcctagtgcatttaggggaagcgaattggatatccaatactgaagttgagtctgct
gtatacacggaggtcattgagaatattgtcaggcaagataaccaatttctaggactgaga
aatcttggagctacctgctatgttaactctttactacaggtttggtttttcatctctgat
tttcgaagcgctatttatagctaccggaacgattttgttcgggataaagtaataaaagtg
gatttattaaccgataaaggatttagtttaatggggttggatgacaatgttgatatagaa
agccattattatgaaaaaattaatataagtaaaaagattagtgacagtataaaatcatct
caagctatccattctagctctcagggtcgacgaagtctgttaaataatttatacgaaagt
gtacctgaatttgttggcaatcaagaacaaatcctgcctgcactagcatctatttgtgat
tacttacaactaatatttgcatttctgcaatttagtaagcgccggtgtgacagttgcaag
tttatctcggaaaggaatgctaccttttatgaactagatttgacggtagcagggcacagt
acgttagaaaagagcttcgatgacttcttcaaattgactacagtatttgaaaaattaaga
tctaggcttagcgataacacatgcggtcattcttattgcgatattaccattctattgcag
aaggaaaagttaaatggacctaatcagtactactgcgaggtgtgtcagagtaagcgtgat
gcttctcgatggattggagtagattcgcttccgccagttttaaatattcagctacttaga
tttatttatgataggaataccggccaaaagaaaaagcttaaatctatattacattttcca
gaagtactcgatatgaccaagtatataagacatgcaccaacagatacttctttcatatat
gacataaaggctgttcttatacatcgcggcgctggtacccaatccggtcattactttaca
catataaaagaagacgagtcgaaatcttggtatgtgtttaacgatgaggcggtatatcag
ttaagtgggaaaaaattacagatagatgaagattcaatggaatctgatgatctaagtcaa
tcgagtaaaaatcctaaaccggttaaagctggttatcacgcatctcgcagcgcctacatg
ttggtgtatacgcgacgctctagtataggagaatattctagcgatttaaaagagaacgtg
attttgcccagaagtattgttaaaatcatcagtgaagataacgtgtccattaagaactgg
atcaatgcagttactgaacaaatgctaagccatacagctgcgataagcaatagagcgcaa
gagataaatcgaatttatccttctctgtcagctgatacagatcaaacttacgaatggatt
ccaactgaatggcttttagaatggctgcgtaaacaagattttaattctcctattgataat
aagacagttttgtgtaatcataagaaattatcacccgattctgtttctatggttaagaga
atcaaccaaatatatgcaaatgaattatacaagttatatggtggaggcccccgtctaact
agggaagatatgtgtaaacaatgtgtggaggaaaaatatcgaagaattcaatttgataca
agattgaataatgattggaaatttattaaatctaccataaccaaaacgttaccaactgga
caaaccgaattttggattggcaaagtatctcttagaaattggaaaggtttaactattaag
aaattcgagaaggatatcagtgaatcttcattaaaaacgaccacggaaaattcggaaccg
gccaaggaagatgccgaaagtgatgctaacctagcagcagatagtgctacttatgatgat
gaatttgaatttaatcaagatctactatgtgaagaacatggtaatttaaccgcagaggaa
tcgaatcgacagatagttagtgaagtagtctggctcatgttaaaatattactttcctgaa
gcagctagctatccagtgggaacacccatttgtcacctttgcgaagaaatcgcaaaagct
agagtagaagatgaagaaactttaagattgtatgctgctactgaaaagaagattctaagt
aaaatatatagtaacaaatctagaccgtcaattgaggatgagggagagttttacgttata
cctttaagtttcgtaagaaaatggcgtaactttataagttacgttaatgtgactacagaa
gaatgggttaatctgcttaatttttatggaactacaagtgaaacttgtaaagaaattaag
atcacggttaaagatagattatgtgaatgttttccgccatgttgccaaatctgtattgat
agcttaatagaaagaagagcaacagagattaaaacgtacagaaacgccagaatttacatc
agtaaggagaatccagatgatgaaaagtgtatcggtccttctcatgatgaatgcgagaat
attcaaaaagaatctcgtaaacgtagcattacgacaatttctccgttgaggcgtagtaaa
cgatgtcgccccggtgaagttgcagttacaatttcatctgatgaaactttacgcgatcta
aagttgaaggttatgactgaatttcaagttgcaccctttgatcaacaccttcatttgaat
ggttgcgaactatttgataatgaccgtacgttgggaaattcaggaatcttacccgattgt
cgtctgacgttgaaaatagatttgcctgtagaaataactgaagaaccccgagggcaactt
aacggttaa

DBGET integrated database retrieval system