KEGG   Trichoplax adhaerens: TRIADDRAFT_58286Help
Entry
TRIADDRAFT_58286  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
tad  Trichoplax adhaerens
Pathway
tad00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tad00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRIADDRAFT_58286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tad01007]
    TRIADDRAFT_58286
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tad03016]
    TRIADDRAFT_58286
Enzymes [BR:tad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     TRIADDRAFT_58286
Amino acid related enzymes [BR:tad01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   TRIADDRAFT_58286
Transfer RNA biogenesis [BR:tad03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TRIADDRAFT_58286
 Prokaryotic Type
    TRIADDRAFT_58286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_His HGTP_anticodon HGTP_anticodon2
Motif
Other DBs
NCBI-GeneID: 6755664
NCBI-ProteinID: XP_002114134
JGI: 58286
UniProt: B3S1G9
AA seq 484 aa AA seqDB search
MAAIREKEEKLKELKLKQKEELATLEAELNQLKLNSKDAHKIALKTPKGTRDFSPKQMAI
RKVLFRTIEKCFERHGAETISTPLFELKEVLTGKYGEDSKLIYDLSDQGGELCSLRYDLT
VPFARYLAMNKIQKIKRYHIAPVYRRDNPSITRGRYREFFQCDYDVAGYDSRIADAECIR
IVSEILSAVDVGSFIIKINNRKILDGMFEISGVPTEKFREISSAVDKLDKMSWEEVRKEM
TDEKGLDGKVADSIGDFVKLKGGLDLISHLEGVVKETGNNSLLVGVNEMRAIIELCHEYN
VTDKILFDLSLARGLDYYTGVIYEAVLTDDKVGVGSVAGGGRYDNLVGMFHPKGKQIPCV
GVSIGIERLFSILEAKAKGNVRTTATDVYVASAQKGLSKHRIALCSNLWDAGIGAETAYS
ENPKLLNQLQHCEVNDIPLVIIIGESELQQGIVKIRDTNSREEVDVSRENMIETINKKLN
QKRG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaattcgagaaaaagaggaaaaattaaaagaattaaagctgaaacagaaagag
gagttagccactttagaagctgaactgaaccaactcaagcttaatagtaaagatgcgcat
aaaattgctctaaaaacgccaaagggtactcgggatttctcacccaaacagatggctatt
agaaaagtattatttcgaactatcgagaaatgttttgaaagacatggagctgaaactatt
tctacgcccttgtttgagttaaaggaagttttaactggtaaatacggtgaagactctaaa
ttgatctacgatttaagcgatcaaggtggagaattatgctcacttcgttacgatttaacg
gtaccatttgcgcgttatctggccatgaacaaaattcaaaaaattaaacggtatcatatt
gctccagtatatcgccgtgataacccttccatcactcggggtagatatcgagagtttttt
cagtgtgattatgatgttgccggctacgattcacgtattgccgatgccgaatgtataagg
atcgtttcagagattctttctgcagtcgatgttggttcgttcataatcaagatcaataat
agaaagatccttgatggtatgtttgaaatatccggagttccgacagaaaaatttcgagaa
atttcctctgctgttgataaacttgataagatgtcatgggaagaagtacgtaaagaaatg
actgacgaaaaaggccttgacggaaaagttgccgatagtatcggtgactttgtaaagtta
aagggcggactcgatttgataagtcatttggaaggtgtagtaaaagaaactggaaacaac
agcttattagttggtgtaaatgaaatgagagcaatcatagagttatgccatgaatataat
gtcacagacaagatcttattcgatcttagcttggctcgtggccttgattactatactggt
gtaatttatgaagctgttcttacagatgacaaggtaggagtcggctccgttgctggtggg
ggccgatacgataatttagtaggaatgtttcatccgaaaggaaagcaaattccatgtgta
ggagtcagcattggaattgagagacttttttctatattggaagcgaaagctaaaggaaat
gtaagaactacagcaactgatgtatatgttgcctcagcacaaaaaggcttgtccaaacat
cgcattgcattatgcagtaacttatgggatgctggaattggggccgaaactgcatactcc
gaaaatcctaagctattaaatcagttacaacactgtgaagttaacgatatcccacttgta
atcattattggagagagtgaattacaacagggtatcgtaaaaatcagagatactaactcc
cgtgaagaggttgacgtaagtcgggagaacatgattgaaactattaacaagaagttaaat
caaaaacgtggctaa

DBGET integrated database retrieval system