KEGG   Trichoplax adhaerens: TRIADDRAFT_59828Help
Entry
TRIADDRAFT_59828  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tad  Trichoplax adhaerens
Brite
KEGG Orthology (KO) [BR:tad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tad01002]
    TRIADDRAFT_59828
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tad04147]
    TRIADDRAFT_59828
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     TRIADDRAFT_59828
Peptidases [BR:tad01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   TRIADDRAFT_59828
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   TRIADDRAFT_59828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Thioesterase Abhydrolase_6 Abhydrolase_5 Abhydrolase_2 Peptidase_S15 Abhydrolase_3 FSH1 Lipase_3 DLH Peptidase_S9 LIDHydrolase Chlorophyllase2
Motif
Other DBs
NCBI-GeneID: 6756991
NCBI-ProteinID: XP_002115921
JGI: 59828
UniProt: B3S6J6
AA seq 293 aa AA seqDB search
MTFYDVKCLTVDCAKSNDMLRIPFSNASQPQQFGMTGTRNFMVKTSDNEFLGAWHVLPKS
LIPTVDDQIDFDNSLKSGKPIFIYFHGNSGSRASYHRIEIYKRFSSFDYHVVTVDYRGYE
DSSGIPSEEGLTEDGISLWKWTKQRSGSSPIYIYGHSLGGAVAVNVAARLCDSDECPKGV
IIQSSFSSLQEACYGHILSKPLKILPFYYSNVLNVVSGEYMVKERIRGVHCPILIIHANQ
DAVIPISLAEELYKAAKSRPASSGKVVLEKLDDTQLGHNNIHRFDRFSDMIRY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacattttatgatgtcaagtgtttaacagttgactgtgcaaaatcgaatgatatgctt
cgtatacctttttctaatgcttctcagccccaacagtttggcatgactggaaccagaaat
tttatggtgaaaacaagtgataatgaattcctgggtgcttggcacgttctccctaagagt
ttgattccaactgtggacgaccagattgatttcgataatagcctgaaatcaggcaaacct
atttttatttatttccatggtaattcgggctctagagcgtcttatcataggatagaaata
tataagagattttcttccttcgattaccacgttgttacagttgactatcgaggatacgaa
gattcttctggaattccttcagaggaaggcctgactgaagatggaatatcattgtggaaa
tggactaaacagaggagcggttcatctccaatatatatttatggtcattcactgggaggc
gctgttgcagtaaatgtcgcagctcgcctatgcgactctgatgaatgtccaaagggtgta
ataatccaaagttcgttctcttcactacaagaagcttgctatgggcatatactcagtaag
ccgcttaagatattgccattctattattccaatgtattgaatgtagtatctggtgaatac
atggttaaagaaaggattcgtggagtgcattgccctattttgataatccatgcaaatcaa
gacgcagttattccaatttctttggctgaggagttatataaagctgctaaatcaagacca
gcatcttcaggaaaagttgtcttagaaaaactcgatgatactcagcttgggcataataac
atccatagatttgatcgattttctgatatgattaggtattga

DBGET integrated database retrieval system