KEGG   Trichoplax adhaerens: TRIADDRAFT_61121Help
Entry
TRIADDRAFT_61121  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
tad  Trichoplax adhaerens
Pathway
tad00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TRIADDRAFT_61121
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     TRIADDRAFT_61121
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tad00537]
 Enzymes
  TRIADDRAFT_61121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 6758357
NCBI-ProteinID: XP_002117145
JGI: 61121
UniProt: B3SA36
AA seq 629 aa AA seqDB search
MDKRSLGNPMKPVQNMQLTLIITLIAFFMSGSAAENGSVTVDTNAGKVEGTMVQVENKDC
AIFLGIPYANPPVGQLRFHLPTPVMKWNNVLQAKTVPNLCYSLNFANFTDVIGSQNEDCL
YLNVFTPKVGASKLPVLVWIHSGSLGMGNAAWWNGEALATLGNMVVVTFDYRRGVLGFLT
GMDRNGMPIITPNLGLHDQQAVFRWVQQNIAQFGGDPQRVTISGHSAGAASVGLFITTTP
MQETLYRQGIMAGGSPVLPTLYYPDLKSTSQAYKNFLSRTTCDISASNQNILSCLRNLPI
GDIISIQGKTSTILGLSEAYRIVVDGTLISDDPKRLLKAGTLKNKNVKVIGGVLKNEGDL
FIALIPQLNNGMPRQMFFNYINREFPNASQAARSVVIYRYTAWSNVTSPANNLRMTSDLF
TDRIFNSPMAYTLNKMSDNGIVTYFYQFNHKIINSGYFPPHVGVVHSMEIPYIFGYPMLN
LSHKGNSYTSEDMKLSRVMINLWSNFVASGNPTSTPVNGITWPRYDSKSKRCLQLASTLG
VQKAPRADYVAFWNDLWPQLASVNNSSPENSTMPETCVSRSYMLATYIQFAVLCTLAAAM
IIFFIFKYRKWPSRNIARLASAGNDNNAL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaggtccttaggcaatccgatgaaaccagttcaaaatatgcaattgacactg
atcattactttaatcgctttctttatgagcggttctgcggccgaaaatggatctgtcaca
gtagatacaaacgcaggtaaagtagaaggtaccatggtccaagtagaaaataaagattgc
gctattttcttaggaataccttatgcaaacccacctgtgggccagttacgatttcatcta
cccacgccggtgatgaaatggaacaatgtgctccaagccaagactgtacccaatctttgc
tatagtctcaattttgccaatttcacggacgtaataggaagccaaaatgaagactgcctg
tatttaaatgttttcacacctaaggtaggagcatccaagctacctgtgctggtatggatc
catagtggctcactaggaatgggcaatgcggcctggtggaatggtgaagcgttggccact
ttaggtaatatggttgtagtaacctttgactaccgtcgtggtgtgctcggttttttgact
ggaatggatcgtaatggtatgcctattataactccaaaccttggcttgcatgatcaacaa
gcagtatttcgttgggtacaacaaaatatagcccaatttggtggagatcctcagcgtgtt
accattagcggtcactctgcaggcgctgcatcggttggtctgtttattacaacaacacca
atgcaagagacgctttatagacaaggcatcatggctgggggctcacctgtactgcctacg
ttatattatccagatcttaaatcaactagccaagcttacaaaaattttctgtctcgtaca
acctgcgacatatctgcctcaaatcaaaacattctaagctgtttacgtaatctgcctatt
ggcgatattatttctattcaaggtaaaactagtactatcttgggccttagcgaagcttac
agaatcgtcgtcgacgggacgttaattagcgacgatccaaaaaggctgttaaaggctggt
actttgaaaaataaaaacgtcaaggtaattggtggagtgttaaaaaatgaaggtgactta
ttcattgctctaattccgcaattaaataatggtatgcctcgccagatgttcttcaattat
atcaatcgagaatttcccaatgcaagccaagctgctcgatcagtcgtcatctatcgttac
actgcttggtcaaacgtaacgtctcctgccaataacttgcgaatgacatcggatcttttc
accgacagaatatttaattcaccaatggcatacacgttaaacaaaatgtctgataatggc
atcgtaacctatttttaccaattcaatcataaaataatcaactctggctacttcccacct
catgttggcgttgtacattctatggaaataccgtatatttttggttacccaatgttaaat
ttgtctcataagggtaattcgtacaccagcgaggatatgaaattaagcagagtaatgatt
aatctatggtcaaatttcgttgcatccggaaatcccacatccacgccagtcaatggtatt
acatggcctaggtatgactctaaaagtaaaagatgtttgcaactagcttcaactcttggt
gtccagaaggcacctcgtgctgactatgtagctttttggaatgatttatggcctcaatta
gcctctgttaataattcatcgccagaaaattcgaccatgccagaaacatgtgttagccgt
tcatacatgcttgctacatacatacaatttgcggtattatgtactttagctgcagctatg
attatattttttatttttaaatatcgaaaatggccttctcgaaatatagcaagacttgca
tctgcaggaaatgacaacaatgctttgtaa

DBGET integrated database retrieval system