KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_0484Help
Entry
TepiRe1_0484      CDS       T02434                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TepiRe1_0484
Enzymes [BR:tae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TepiRe1_0484
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TepiRe1_0484
    1.1.1.-  
     TepiRe1_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 DUF2254 DAO
Motif
Other DBs
NCBI-ProteinID: CCP25161
UniProt: F4LUR8
Position
472306..473364
Genome map
AA seq 352 aa AA seqDB search
MKAAVWHGYKDVRIEDVPEPKLSPDCVKIKVYWAGICGTDRHEYVGPNFIPTEKPHRLTQ
RTAPLIIGHEFTGIIVEVGGNVTGWKVGDRVTANGSLTCKSCEMCKTGRYNICSKLGFLG
VGDDGAFAEYVTVEADRLFRIPDNVTLRQGLLAEPIACGIHSTNLINDVQGKDVVVIGPG
IIGLGCFFAATLKGASKVLVAGIGDNREALIRRYNGDYVDTQKTDLAEYVKNWSNGKMAD
IVYECVGVQQTLNNAISISKPGAKIMVMGVFGQKPLISMNDLQEGERVLMTSQAHLNEIE
TALEYFSKGKIDADELITREVTLDTLVEDGFEELLKNASKHIKVAIKIVDTK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtttggcatggctacaaagatgtaagaatagaagacgttcctgaaccg
aaactgagcccagattgcgtgaaaattaaggtttactgggcaggcatatgcggtacagat
cgccatgagtatgttggcccaaattttattcctacagaaaagccccatcgattaactcag
cgaacagctccattaataattgggcatgagtttacaggaatcatcgtagaggtaggggga
aatgttactggatggaaagtgggagaccgggttactgcaaatggaagtttaacctgtaaa
agctgtgaaatgtgcaaaacaggacggtacaacatttgctcaaaactgggatttctaggt
gtaggcgatgatggagcatttgccgaatatgtcactgtagaggctgataggctgttccgt
attccggataatgttacacttagacaaggcctactggctgagcccatcgcttgtggcata
cattctacaaatcttataaatgacgttcaaggtaaggatgtcgttgtcattggtcccggt
attattggattaggatgctttttcgcggcaactctcaagggcgcatcaaaagttttggtt
gcgggaataggtgataatcgggaggcgttaattcgccgttataatggcgattatgttgat
acccaaaagacagatttggctgagtatgttaaaaactggtctaatggtaaaatggcagat
attgtttacgagtgtgttggagttcaacaaacattaaacaatgcaataagcatctcaaaa
cctggagcaaaaataatggtaatgggtgtttttggccagaaaccgctgatttccatgaat
gatttacaggagggcgagcgggtgctgatgacatcacaagcccatttaaatgagatagaa
actgcattggagtacttttctaaaggaaaaattgatgcagatgaactaattacaagagaa
gtaacacttgatactcttgtagaggacgggtttgaagagcttttgaaaaacgcttctaaa
catattaaggtcgctattaagattgtagatacaaaataa

DBGET integrated database retrieval system