KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_1558Help
Entry
TepiRe1_1558      CDS       T02434                                 

Gene name
ackA
Definition
(GenBank) acetate kinase A and propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00430  Taurine and hypotaurine metabolism
tae00620  Pyruvate metabolism
tae00640  Propanoate metabolism
tae00680  Methane metabolism
tae01100  Metabolic pathways
tae01120  Microbial metabolism in diverse environments
tae01200  Carbon metabolism
Module
tae_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:tae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TepiRe1_1558 (ackA)
   00640 Propanoate metabolism
    TepiRe1_1558 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    TepiRe1_1558 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    TepiRe1_1558 (ackA)
Enzymes [BR:tae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     TepiRe1_1558 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CDI40739
UniProt: F4LVK7
Position
complement(1484908..1486110)
Genome map
AA seq 400 aa AA seqDB search
MLKVLVINCGSSSLKYQLFNMKDQSVLAKGLVERIGLEVGMLKHMPYCKDKIEVSDNIPN
HKVAVKMMLDALLDKNHGVLKDISEISAVGHRVVHGAEKFSGSVKITDEVMDVLKECVAI
APLHNPPNIVGIEAAREMLPDVPMVGVFDTAFHQTMPQYAYMYGLPYELYEKYAVRRYGF
HGTSHCFVSAEAAKMLNRPIEELKMITLHLGNGSSITAIKNGKSIENSMGFTPLEGIIMG
TRCGNIDPAIVPFIMEKEGISPDKMNEYLNKKCGVYGISGVSSDFRDLEEAAKNGNKRAD
LALKMFSYQAKKFIGSYAAIMNGLDAIVFTGGIGENSATMRQMICKDMEYLGIKIDEAKN
QVRGKQADISFEEAKAKALVIPTNEELMIALDTMSLVKTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaaggttcttgttatcaattgcggcagttcgtctttgaaatatcagctcttcaat
atgaaagatcaatcagttttggctaagggtttagtggaaagaataggtcttgaagttgga
atgctcaagcatatgccttactgtaaagataagatagaagtatcggacaatattccaaac
cataaggtagccgtaaaaatgatgcttgatgctcttttagataaaaatcacggtgttcta
aaagatatttcggaaatatcagcagtaggtcatcgcgtagtacatggtgcagaaaaattt
tccggctctgtaaaaataacggatgaagtcatggatgtgttaaaagaatgtgtagccatt
gctccattacataatccgcctaacattgtaggtattgaagcagctcgggagatgttaccg
gacgttccgatggttggagtgttcgatacggcatttcatcaaactatgcctcaatatgct
tatatgtatgggttaccttatgaattatatgaaaaatatgccgtaagaagatacggcttt
catggtacttctcattgctttgtatcagctgaggctgcaaaaatgttaaacaggcctatt
gaagaattaaaaatgattacattgcacttgggcaatggttcaagtataacagcgatcaaa
aacggtaaatctattgaaaacagcatgggatttacgccgctggaaggtattataatggga
acacgctgtggcaatatagatccggcaatagtgccatttataatggaaaaagaaggaata
tcaccggataaaatgaacgagtacctgaataaaaaatgcggagtctatggaatttccgga
gttagcagtgatttcagagacttagaagaagcggcaaaaaacggtaataaacgtgccgac
ttagccttaaagatgttttcttatcaagctaaaaaattcatcggttcctatgctgcgatc
atgaatgggcttgatgctattgtgtttaccggcggtattggagaaaattctgctacaatg
aggcagatgatttgtaaggatatggaatatttaggaataaagattgatgaagctaaaaac
caagtcagaggaaagcaggcagatatttcttttgaagaggctaaagcaaaagcgcttgtt
attccaacaaatgaagaactaatgatagccttagatacgatgtctcttgttaaaactgct
tga

DBGET integrated database retrieval system