KEGG   Tepidanaerobacter acetatoxydans Re1: TepiRe1_1582Help
Entry
TepiRe1_1582      CDS       T02434                                 

Gene name
coaBC
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein CoaBC; phosphopantothenoylcysteine synthetase/decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
tae  Tepidanaerobacter acetatoxydans Re1
Pathway
tae00770  Pantothenate and CoA biosynthesis
tae01100  Metabolic pathways
Module
tae_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    TepiRe1_1582 (coaBC)
Enzymes [BR:tae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     TepiRe1_1582 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     TepiRe1_1582 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF1411 adh_short_C2
Motif
Other DBs
NCBI-ProteinID: CCP26354
UniProt: F4LVN0
Position
complement(1508383..1509594)
Genome map
AA seq 403 aa AA seqDB search
MLKDKFVVIGVTGSIAIYKAVELVRLFKKAGANVQVVMTKSACEFVKPLTFQVVSQNPVI
TDMFAEPSSWEVEHVALADKADIFLVAPATANIIAKLAAGIADDMLTSTALATNAKKIIV
PAMNVNMYENPVTQKNIEFLRATGAIIMEPEEGELACGYTGKGRFPKPQNIITQVKIILG
KDGDLKDKKFLITAGPTREPIDPVRFITNHSSGKMGYALAERAIHRGGEVILISGPTNLD
PPLGLYKYIQVETAQEMFKAVMQHYPEVDVVIKAAAVADFSPKHFEAEKIKKHGFNMIIE
LKKNPDILQELGNKKQHQILVGFAAETTNAAANAQDKLIRKNLDFIILNDLTQEGAGFAK
DTNIVKILYRDGRIEELPKMLKKDLADEILDRVFLYMEQYQKL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagataagtttgtggtaataggagttaccggcagtatagcaatttataaagcg
gtagaacttgtgagattatttaaaaaagccggtgctaatgtccaagttgtaatgacaaaa
tccgcatgcgaatttgtcaaaccattaacttttcaagttgtgtcacagaatccggttatt
actgacatgtttgcagaaccttcttcatgggaagttgaacatgtagcattggccgataaa
gccgatattttcttggtagcgccggcaactgcaaatattattgctaagttggccgcagga
atagccgatgatatgctgacttcaacggcacttgccactaatgcaaaaaagataattgta
cctgctatgaacgtaaatatgtatgaaaatcctgtaacacagaaaaatattgaattttta
agagcaaccggtgctattatcatggaaccggaagaaggtgaattagcatgcggatatact
gggaagggtaggtttcccaaaccacaaaatatcataactcaagttaagattattttggga
aaagatggtgatttaaaagataagaagtttttaataaccgctggtccaaccagagaacct
attgacccagtaagatttatcacgaaccattcttccgggaaaatgggttatgctttggcc
gaaagagcaattcatcgcggcggagaagttatattgatttcagggccaacgaatcttgat
ccgccactgggactttataaatacatacaggtcgaaacagcccaggaaatgtttaaagca
gtaatgcaacattatccggaggttgatgttgttattaaagcggcggctgttgcggatttt
tcacccaaacattttgaagcggagaagataaaaaaacatggctttaatatgattatagaa
cttaagaaaaatcctgacattttacaagaattgggaaacaaaaaacagcatcagatattg
gtcggatttgccgctgaaacaactaatgcagcagctaatgctcaagataaattaataaga
aaaaatcttgattttattatcttaaatgaccttacacaagagggagccggatttgccaaa
gatacaaatatagtaaaaatattatacagagatggtcgaattgaagaactgcctaagatg
ctaaaaaaagatttagctgatgagattttagatagagtatttttatatatggagcaatat
caaaaactttaa

DBGET integrated database retrieval system