KEGG   Thermosipho africanus: THA_1126Help
Entry
THA_1126          CDS       T00797                                 

Definition
(GenBank) thermostable monoacylglycerol lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
taf  Thermosipho africanus
Brite
Enzymes [BR:taf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     THA_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 BAAT_C DLH Abhydrolase_5 PGAP1 DUF1057 DUF676 Abhydrolase_3 Esterase DUF915
Motif
Other DBs
NCBI-ProteinID: ACJ75579
UniProt: B7IHL5
Position
1149767..1150543
Genome map
AA seq 258 aa AA seqDB search
MNLLKFSTKIKTVEASQPIFLEGSNGIGVLLIHGYTGSPHDMKFLAEKLNKEGFTVYVPR
LPGHGTSSEDFLKSNHRDWLRRVIDSYFDLSGKCKEVYVAGLSMGGVLTLILASIFNPKK
IVSIAGAIFTTEKKIALTPYISLFLKKMKREDYNETYEDKDLQYLSKEYWSYNWPLQAKY
LYKLMKIARKRLKYINSDILILASEKDLTVPLEAAHYIYNNVSSKNKELKIFKKTGHVMT
NDIEKEEVAETIIEWFKK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattaaaatttagtactaagataaaaacggtggaagcatcacaaccaattttt
cttgaaggaagtaacggcataggtgttttacttattcatggttatactggaagtcctcat
gatatgaaatttttggctgaaaaattaaataaggagggctttactgtttatgttccaaga
ctgcctggtcatggtacatcaagcgaagattttttaaaaagcaatcacagagattggctt
agaagagttatagatagttattttgatttatctggaaagtgtaaagaggtttatgtagct
ggtctttccatgggtggtgtattaacattaatacttgcaagtatttttaatccgaagaag
attgttagcattgcaggtgctatttttactactgaaaaaaagatagctttaactccttac
atctctctttttttgaaaaaaatgaaaagagaagactacaatgaaacttatgaagataaa
gatttgcagtatctttcaaaagaatattggtcatacaattggccacttcaggcaaagtat
ttgtataaattaatgaaaattgctagaaaaagattaaaatatataaattctgatatttta
attcttgcatcagaaaaggatttgacggtcccgctagaagctgcgcattatatttataac
aacgtttcttcaaagaacaaagagttgaaaatctttaaaaaaacggggcatgtaatgaca
aatgatatagaaaaagaagaggttgcagaaacaattattgaatggtttaaaaaatag

DBGET integrated database retrieval system