KEGG   Thermosipho africanus: THA_1163
Entry
THA_1163          CDS       T00797                                 

Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
taf  Thermosipho africanus
Pathway
taf00472  D-Arginine and D-ornithine metabolism
taf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    THA_1163
Enzymes [BR:taf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     THA_1163
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ACJ75615
UniProt: B7IHQ1
Position
1189697..1190071
AA seq 124 aa
MKPRKDDFLERSKHLQKMTDDELNQYFWHLVEKVVDPLIELAKTHTSPSVERSVLLRMGF
NSIEASKLVDMIFQRGLLGKGAGHIVWKIAKEKNLDIIEAGRALIEGKYWEDVDRIFKGV
NNNA
NT seq 375 nt   +upstreamnt  +downstreamnt
ttgaagcctagaaaagatgattttttggaaagaagcaagcatctacaaaaaatgaccgat
gatgaattaaatcaatatttttggcatcttgttgaaaaggttgtagatcctctgatagaa
cttgcaaagacccatacatctccatctgttgaaagatcagttcttttgaggatgggtttt
aatagtattgaggcatcaaaacttgttgacatgatattccagagaggactccttggcaaa
ggcgctggtcatattgtttggaaaattgcaaaagagaaaaatttggatattatagaagca
ggtagggccttgattgaaggaaaatattgggaagatgttgataggatcttcaaaggggtg
aataataatgcttga

DBGET integrated database retrieval system