KEGG   Thermosipho africanus: THA_1164
Entry
THA_1164          CDS       T00797                                 

Definition
(GenBank) methylmalonyl-CoA mutase, C-domain/subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
taf  Thermosipho africanus
Pathway
taf00472  D-Arginine and D-ornithine metabolism
taf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    THA_1164
Enzymes [BR:taf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     THA_1164
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ACJ75616
UniProt: B7IHQ2
Position
1190064..1192256
AA seq 730 aa
MLDPKKPIDIDEILKDLDKYRPKRKGWTWRKRLPEGSKIGDYEYYQVSENLKNSIPLPAA
HYFGNIDPQPEVVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHYDGLIEGTP
EGVGGIPITRKQLRATRKALDLIEEEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQD
PQYNVLYRGINPIRSFVDAAVAKKIMASVNMLQIDGAHNANASAKLAWTVMPELLVQHGI
NCMYSLKAGMKKEYIALSTVPPVVAPMPEFRYNLPYAVALRELFDGFRFRAQMNTRYIES
DLFDATRIHVLNTLISRLTSADLQSTITPDEGRNVPWHVNSIRGVETAKHTLVALDGMKK
YVKIDEKKIREKVRELKMRAILMLEEILDMGGYFEALEAGMFVDNGYYPERIGDGIARKK
DGEIAAGTVVPRDEDYMAPVCEHFGYNNLPEGIEKPCDLIGGCTLHNPDKIQFIDELDET
DNVNVRLERIRDMKKRNVIKPEVEWFADGWIQLDMTFALPEELAEAAAISLCKKLGLEEI
TIIHKGVLHPAEGTYIEVKAKVPFEIEVDKLEIPKKPETLPEEEIFEYVKNNPFHVVAGT
VGNDEHSVGLREVLDIKHGGIEKYGIKYTYLGTSVPPEKLIDAAIETGAKAILASMIITH
NDVHVQNMRKLHELAIEKGIRDKIIIVAGGTQITDDLAKENGMDAGFGRGTKGVHVASFL
VKKLKEMENK
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgcttgatccaaaaaagccaatagatatagatgaaatattgaaagatttggacaaatat
cgcccaaagagaaaaggatggacttggagaaaaagactcccagaaggttcaaaaattggg
gattatgaatattaccaagtcagcgaaaatttaaaaaattctattccacttccagctgca
cattactttggaaatattgatcctcaaccggaagtagtaattacctcagaaatagcttcg
ggaaggttcgaagatgatataagaaggatgaggatggcagcttggcatggtgcagatcat
attatggttatacgaactcttggtcaatcacactatgatggactcatagagggtacacca
gaaggtgttggtggaattcctattacaagaaagcaactacgtgcaacaagaaaagctctt
gacttaattgaagaagaagtaggccgtccaattaattttcacagttatgtctcaggtgtt
gcagggccggagatagctgttttatttgctgaagaaggagttaatggtgcacaccaggat
ccacaatacaatgttttgtatagaggtataaaccctattagatcttttgttgatgcagct
gttgcaaagaagataatggcgtctgttaatatgctccaaattgacggtgcacataatgca
aatgcatcagcaaaacttgcgtggacggtaatgcctgaacttcttgtccaacatggaata
aactgtatgtattctttaaaagcaggaatgaaaaaagaatatatagcactatccacagtt
ccaccagttgttgctccaatgcctgagtttagatataacctaccatatgctgtagcatta
agagaattgtttgatggatttagatttagagcccaaatgaatacaagatacatagaatct
gaccttttcgatgctacaagaatacacgttttaaatacattaatttcaagacttacatca
gcagatttacaatcaactattactccagatgaaggaaggaatgttccatggcacgtaaat
tcaattcgtggcgttgaaacggcaaaacatacattggttgcattagatggaatgaaaaaa
tatgtaaaaattgatgagaaaaaaataagggaaaaagtaagagaattgaaaatgagagct
attctcatgctggaagaaattttggatatgggtgggtactttgaagcattagaggctgga
atgtttgtagataatggatactacccagaaagaattggtgatggaatagcaaggaaaaag
gatggagaaattgccgctggaacagttgtaccaagggatgaggactatatggctcctgtt
tgtgagcattttggatacaacaatcttcctgaaggtatagaaaaaccttgtgatcttata
ggcggttgtacgcttcataaccctgataaaattcagtttattgacgaattagatgaaaca
gataatgtgaatgtaagacttgaaagaatcagagatatgaaaaaaagaaatgtaataaaa
cctgaggttgaatggtttgcagatggttggattcaacttgacatgacatttgcattacca
gaagaattagcagaagctgctgcaatttctttgtgtaagaaacttgggttagaagaaatt
acaataatacacaagggagttcttcatcctgcagaaggaacatatattgaggtaaaagca
aaggttccgtttgaaattgaagttgataaattggagattccaaagaaacctgaaacattg
ccagaagaggaaatttttgaatatgtcaaaaacaatccatttcatgttgtagcaggtact
gttggtaacgacgaacattcagtgggattaagagaagttttggatataaaacatggtgga
attgaaaaatatggaattaagtatacttatcttggaacaagtgtccctcctgaaaaactc
attgatgcggcaatagaaacaggtgcgaaagctattttagcatctatgattattacacac
aacgatgttcacgttcaaaacatgagaaaactccatgagcttgctatagaaaaaggaatt
agggataagattattatagttgcaggtggaactcaaataacagatgatcttgcaaaagaa
aatggaatggatgcaggctttggaagaggaacaaaaggtgtacatgttgcatcattcttg
gtaaaaaaattaaaagagatggaaaataaatag

DBGET integrated database retrieval system