KEGG   Thermosipho africanus: THA_130
Entry
THA_130           CDS       T00797                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
taf  Thermosipho africanus
Pathway
taf00061  Fatty acid biosynthesis
taf00780  Biotin metabolism
taf01100  Metabolic pathways
taf01110  Biosynthesis of secondary metabolites
taf01212  Fatty acid metabolism
taf01240  Biosynthesis of cofactors
Module
taf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    THA_130 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    THA_130 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    THA_130 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:taf01004]
    THA_130 (fabG)
Enzymes [BR:taf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     THA_130 (fabG)
Lipid biosynthesis proteins [BR:taf01004]
 Fatty acid synthase
  Component type
   THA_130 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase ADH_zinc_N Methyltransf_11 THF_DHG_CYH_C RmlD_sub_bind Methyltransf_25
Other DBs
NCBI-ProteinID: ACJ74638
UniProt: B7IEX4
Position
complement(123528..124271)
AA seq 247 aa
MRLKDKVCIITGAASGIGKAAALLFSKEGATIIACDMSEENLKVLKEENPGPGVIDTYVL
DVTDRKRINEVVEEVASKYGKIDVLVNNAGITRDALLLKMKEEDWDAVINVNLKGVFNMT
QAVAPFMIKAGKGSIINTSSIVGVFGNIGQTNYSATKAGVIGMTKTWAKELARKGAQIRV
NAVAPGFIKTPMTEKVPEKIINALNEKIPLKRMGEPEEVANLYLFLASDESSYITGQVIG
IDGGLVI
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagattgaaagataaagtttgtattataaccggagcagcaagtgggataggaaaggca
gctgcattgttattttcaaaagaaggtgctacaatcattgcgtgtgatatgtccgaagaa
aatttaaaagtattaaaagaagaaaatcctggtcctggagttattgatacttatgttttg
gatgttacagatagaaagagaataaatgaggttgttgaagaagttgctagtaaatatggt
aaaattgacgttttagtaaataatgcaggaataacgagggatgctcttttgttaaaaatg
aaggaagaagattgggatgcagtaattaatgttaatctaaaaggtgtatttaatatgacg
caagcagttgcaccttttatgattaaagcaggtaaaggaagtattattaatacatcttca
attgttggggtttttggaaatataggtcagacaaattattccgcaacaaaagcaggtgta
attggtatgactaaaacttgggcaaaagagcttgcaagaaaaggtgcccaaattagagta
aatgccgttgctccaggatttataaaaactcctatgactgaaaaagttcctgaaaaaata
attaacgctttgaatgaaaaaattccattaaagagaatgggtgaacctgaagaagttgca
aatctctatttattcttagcttcagatgaatcttcatatattacagggcaagtaattggt
atagatggtggattggtaatttaa

DBGET integrated database retrieval system