KEGG   Thermosipho africanus: THA_1612Help
Entry
THA_1612          CDS       T00797                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
taf  Thermosipho africanus
Pathway
taf00430  Taurine and hypotaurine metabolism
taf00620  Pyruvate metabolism
taf00640  Propanoate metabolism
taf00680  Methane metabolism
taf01100  Metabolic pathways
taf01120  Microbial metabolism in diverse environments
taf01200  Carbon metabolism
Module
taf_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THA_1612 (ackA)
   00640 Propanoate metabolism
    THA_1612 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    THA_1612 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    THA_1612 (ackA)
Enzymes [BR:taf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     THA_1612 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase FAO_M
Motif
Other DBs
NCBI-ProteinID: ACJ76050
UniProt: B7IDH3
Position
complement(1617169..1618389)
Genome map
AA seq 406 aa AA seqDB search
MIVLVVNSGSSSIKYQLLDMDNEKVLCKGLAERIGIPGSRIVHKKDGEKFVIEHPMANHD
EALQLVLQTLKDEKMGAIKDFKEIDAVGHRVVHGGEKFSGSVLIDDEVINAIEEFSYLAP
LHNPPNLMGIKAIMKLLPGVPNVAVFDTAFHAKMPKKAYLYAIPYEYYEKYKIRRYGFHG
TSHRYVSRRTAEILGLDYNKSKIITVHLGNGASIAAVMNGKSVDTSMGFTPLEGLVMGTR
SGDLDPSIVTFLIEKEGLSPEEVYTILNKKSGVLGLTSNFSSDMRDIEDKALENDPLCRL
VLDIYEYRIAKYIGAYVAAMNGVDAISFTAGVGENSPITREEICENYLSYLGIKIDKEKN
NVKGEERIISTPDSKVKVLIVPTNEELMIARDTKEIIEKGIKKLEY
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattgtattagttgtaaacagtggaagctcttctataaaataccaactgttggatatg
gataacgagaaagttctttgtaaaggcttagcagaaagaatcggaatccctggaagcaga
atagtacataaaaaagacggcgaaaaatttgttatagaacatccaatggcaaatcatgac
gaagcgttacagcttgttttgcaaacactaaaagatgaaaaaatgggtgctataaaagac
tttaaagaaattgatgcagttgggcacagagttgttcatggtggagaaaaattctccggt
tctgttttaatagatgatgaagttataaatgcaatagaagaattttcataccttgctccg
ctacataatcctccaaacctaatgggaattaaagcaattatgaaacttttacctggagtg
cctaatgtagctgtatttgatactgctttccatgctaaaatgcctaaaaaagcttatcta
tatgctattccatatgaatactacgaaaaatacaaaatcagaaggtatggattccacgga
acaagccacagatatgtttcaagaagaactgctgaaatacttggattagactacaataaa
tcaaaaattataactgttcacttagggaacggagcatcaattgcagctgtaatgaatgga
aaaagtgtagatacatctatgggattcacaccacttgaaggtttagttatgggaactcgc
tctggagatctagatccttcaattgtaactttcttaattgagaaagaaggtttaagtcct
gaagaagtttacactatcttaaacaaaaaaagcggtgttttaggacttacaagcaatttc
agttcagacatgagagatatagaagacaaagctcttgaaaatgatccattatgcagatta
gtacttgacatttacgaatatagaattgcaaaatatataggtgcatatgttgcagcaatg
aatggagttgatgctatatcatttacagctggagttggagaaaactcaccaattacacgt
gaagaaatttgtgaaaactatttgagttaccttggtattaagatagacaaagagaaaaac
aatgtcaaaggagaagaaagaataatatcaactcctgactccaaggttaaagttcttatt
gtcccaaccaatgaagaattaatgattgcaagagatactaaagaaataattgaaaaagga
attaaaaaactagaatattaa

DBGET integrated database retrieval system