KEGG   Thermosipho africanus: THA_555Help
Entry
THA_555           CDS       T00797                                 

Definition
(GenBank) fhs formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
taf  Thermosipho africanus
Pathway
taf00670  One carbon pool by folate
taf01100  Metabolic pathways
taf01120  Microbial metabolism in diverse environments
taf01200  Carbon metabolism
Module
taf_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:taf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    THA_555
Enzymes [BR:taf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     THA_555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: ACJ75043
UniProt: B7IG29
Position
complement(564178..565833)
Genome map
AA seq 551 aa AA seqDB search
MKTDIEIAREAKLEKITKIAEKIDISEEYVEPYGKYIAKVDLKIWEKVKNNKDGKLILVT
AMTPTPAGEGKTTTSIGLSMALNRLGKKSIVTLREPSLGPVFGIKGGAAGGGYSQVLPME
NINLHFTGDIHAVSAAHNLISAVIDAHIKFGNELGIDPTRIYWKRTIDMNDRALRNIVVG
LGGSANGQPREDGFIITAASEIMAILCLAKDLKDLKERLSNIVVAQSYDKKLIKVKDLKI
EGALAVLLKDAIKPNLVQTIENTPAFVHGGPFANIAHGTNSIIATKLALKLSDYVVTEAG
FAADLGAEKFLDFVSPTAGYDVNAVVVVATIKALKYHGGVKKDELDNENVEAMLKGMENL
RVHVENLKKYNVPVIVALNVFGSDTQRELDEFSKNCEIPHALVYAFEKGGEGAVDLANLV
LENIKESQYKPLITSEMSLEEKIETLAKEIYRAGNVIYTDKAKSKLKFLRKHGYDTLPVI
VAKTQSSISDDPKKINAPSGYTFTIRDFELSAGAGFIVALAGDIMRMPGLSKIPNAVNID
IDEEGNIIGLS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgatattgaaattgcaagagaagcaaaattggagaaaataacaaaaatagca
gaaaaaatagacatatcagaagaatatgttgagccatatggaaagtacatagcaaaagtt
gatttgaaaatatgggaaaaagttaaaaataacaaagatggaaagttaattttggtaact
gcaatgaccccaaccccagccggagaaggtaaaacaacaacaagtatagggctttctatg
gcactaaatagactcgggaaaaaatcaatagtgacacttagagaaccatcacttggtccg
gtatttggaattaaaggtggggctgccgggggaggctattctcaagttctcccaatggag
aatataaatcttcattttaccggtgatatacacgcagtttcagcggctcataatttgata
tcagcagtaatagatgcacatataaagtttggaaatgaacttggaattgatcccactcgt
atatattggaaaagaaccattgacatgaatgatagggctcttagaaatatagttgtaggt
cttggaggaagtgcaaatgggcagccacgtgaagatggatttataattactgctgcatct
gaaattatggctattttgtgtcttgctaaagatcttaaggatctaaaagaaagactttca
aatatagttgtagctcaaagttatgacaaaaagcttattaaagtaaaagatttaaaaatt
gaaggagcacttgcagttttattgaaagatgctattaaacctaatcttgttcaaacaatt
gaaaatacacctgcatttgtacacggagggccatttgcaaatattgcccatggaacaaat
agcataattgcaacaaaattagcgttaaagctttctgattatgtagtaacagaagcagga
tttgcagcagatttaggtgcggaaaagtttcttgattttgtttctccaactgcaggctac
gatgtaaatgcagttgttgtagttgctacaataaaagctttaaaataccatggtggtgta
aagaaagacgagcttgacaatgaaaatgttgaagctatgttaaaaggtatggaaaatctt
agggttcatgttgaaaatttgaaaaaatataatgttccggttattgtagctctcaatgtg
tttggaagtgacacccaaagagaattagatgaattttcaaagaattgtgaaattcctcat
gcacttgtttatgcctttgaaaagggtggagaaggtgctgttgatttagcaaatcttgtt
cttgaaaacataaaagaatctcaatataaacctttaataacttctgaaatgagtcttgag
gagaaaattgaaacacttgcaaaagaaatttacagggcagggaacgtgatttataccgat
aaagcaaagagtaaattgaagttcttaagaaagcatgggtatgatacactaccggtaatt
gttgcaaaaacacaatcaagtatttctgatgatccaaaaaagattaatgcaccatctggt
tatacttttacaataagagattttgaactttctgcaggtgcagggtttatagtggcactt
gcaggtgacattatgagaatgccggggctttcaaaaattccaaatgcggttaatatagac
attgatgaagaaggaaatataattggtttatcataa

DBGET integrated database retrieval system