KEGG   Thermosipho africanus: THA_898Help
Entry
THA_898           CDS       T00797                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
taf  Thermosipho africanus
Brite
KEGG Orthology (KO) [BR:taf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THA_898
Enzymes [BR:taf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     THA_898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Radical_SAM AP_endonuc_2 Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: ACJ75357
UniProt: B7IGZ3
Position
921034..921834
Genome map
AA seq 266 aa AA seqDB search
MLVDFHMHSTASDGTFNPNELVTLVKERKIECFSLTDHDTIDGVKQIKEKNFIPGVEISI
EHPTTLHILGYGFDINNEKFNKVLDQLKQYRYERNVKMVEKANALGFDITLEELLEEANG
TLIGRPHFASLLLKKGYVKDRKEAFEKYLKRGMPLYEDKKRLDLENAIEIITQAGGIAVF
AHPYQTSEDEDEIEKLLKKMVDLGLKGIEVYYSKHTKGMIETYEKLAKKYNLVKTAGSDF
HGQNTPDIELGIEVRRENIKEFLSLF
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtagactttcacatgcactcaacagcatcagatggaacgtttaatccaaatgag
cttgtaacactagtaaaagaaagaaaaattgaatgtttctcactaactgaccatgatact
atagatggagtaaaacaaatcaaagaaaaaaactttatcccaggtgttgagataagtatt
gagcatcctacaactcttcatattctaggttatggttttgatataaataacgaaaaattt
aataaagttcttgatcaattaaaacaatacagatacgaaagaaacgtaaagatggttgaa
aaggctaatgcacttggatttgatataactcttgaagagttattagaagaggcaaacggt
accctaattggacgtccacactttgcctcgcttttattgaaaaaaggatacgttaaagat
agaaaagaggcatttgaaaaatacctcaaacgaggaatgccgctgtatgaagataaaaaa
aggttagaccttgaaaatgcaattgaaataattactcaggcaggtggaattgctgtattt
gcacacccatatcaaacaagtgaagatgaagatgaaattgaaaagctacttaaaaaaatg
gttgatttaggactaaaaggtatagaagtatattattcaaagcatacaaaaggtatgatc
gaaacatatgaaaaactagctaaaaagtacaaccttgtaaaaacggcaggttcagatttc
cacggtcaaaatacaccggatatagaacttggaatagaagtaagaagagaaaatataaaa
gaatttttatcacttttttaa

DBGET integrated database retrieval system