KEGG   Thermanaerovibrio acidaminovorans: Taci_0192
Entry
Taci_0192         CDS       T01129                                 

Definition
(RefSeq) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00230  Purine metabolism
tai01100  Metabolic pathways
tai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Taci_0192
Enzymes [BR:tai01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Taci_0192
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C KA1
Other DBs
NCBI-GeneID: 8630002
NCBI-ProteinID: YP_003316714
UniProt: D1B829
Position
complement(209316..211562)
AA seq 748 aa
MREGKVGIPLNRLDGEAKVRGTFRFLADRLPGDVLHGRLITSPVANGWVHGFQVSEANRV
DGLVRIFTPQDDPLLKPFNSAVYMEDQTDLRDERIFTDRPLFVGDIVGAVLARTPQGAAE
AALRVRVLCQAMEPVVSIHQALERPFLDSRPGRLEGRISAGEEVHQEECETLSVTASTPK
VHHGAMEPHICLSYMDGPTLVVESPCQMPFAVRYVLSQALGLPMSRVRVIKAPMGGTFGG
KQEVILETRCALMTLLTGRPVLLTTSREETINSTRSRAATVGQVHMTARRDGRILSRRIH
VICDAGAYASGGHRITMAMGKKAFRLYRIPHQEFLGITVFTNTVPSGPCRGYGSPQIHAI
TEIAMDLMARRLRMDPAELRLRNLVHPFDPDPTGAPNLGNARVRDCLTRGMEAFRWAERR
DELENGKGGRFVQGVGLACASHGNGYFGSPFLDVMGISIRLAEDGSALVSGAFQELGNGT
MTAMTQIAAQALSLPVERVFVSEADTHLSPFDVGCVASRVTYVCGSAVLEAARSLKDLMA
EAFLRLAGLEGDPSRVRFADGRLELDGTSMTYRDLATRALRELKLELASHGTHHPVDNPA
SFGVHFAQVEVDTLTGLVRVTDYLACHDVGRAINPKLLRGQILGGVQMGIGMALSEELRY
DRSGRPLCGSLSRYHMPNCPDMPDVKVLLVEEGEEGGPFGAKSIGEIATVPVAPAICNAV
NMALGTSMTELPFTPERIVSAMNGGNVR
NT seq 2247 nt   +upstreamnt  +downstreamnt
ttgagggaaggcaaggttgggatccccctgaaccgcctggacggggaggccaaggtgcgg
ggcaccttccgcttcctggcggatcggctccccggcgacgtgctccacgggaggctaata
accagcccggtggccaacggctgggtccacgggttccaggtctctgaagccaaccgggtg
gacggcctggtgcgcatattcaccccccaggatgacccgctcctcaaacccttcaacagc
gcggtctacatggaggaccagacggaccttagggacgagaggatattcaccgaccggccc
ctcttcgtgggggacatagtcggggcggtgttggccaggacaccccagggggcagcggag
gcggccttaagggtcagggtcctatgtcaggcgatggagccggtggtgtccatccaccag
gccctcgagaggcccttcctggactcaaggcccgggcggctggaggggcggatatccgcc
ggggaggaggttcaccaggaggagtgcgagaccctctcggtgacggcaagcaccccaaag
gtacaccacggggccatggagccccacatctgcctcagctacatggatggccccaccttg
gtggtggagtccccctgccagatgcccttcgcggtccggtacgtgctctcccaggcgctg
ggactccccatgagccgggtccgggtgatcaaggcccccatggggggcacattcgggggc
aagcaggaggtgatcctggagacccgatgcgccctcatgaccctgctcaccgggcgcccg
gtgctcctaaccacctcccgggaggagaccatcaactccaccaggagccgggccgccacg
gtggggcaggttcacatgaccgcccggcgggacgggaggatactcagccgccgaatccac
gtgatctgcgacgcaggggcctacgcctccgggggacacaggataaccatggccatgggg
aagaaggccttccggctctaccgaatcccccatcaggagttcctaggcatcacggtgttc
accaacacggtccccagcgggccctgcaggggctacggatccccccagattcacgccata
accgagatagccatggacctgatggcccggcgcctccggatggacccggcggagctgagg
ctccgcaacctggtgcaccccttcgacccggaccccaccggggccccgaacctgggtaac
gcccgggtcagggactgcctcacccggggcatggaggccttccgctgggcggagaggcgc
gacgagctggagaatggcaaggggggccggttcgtccaaggggtggggctcgcctgcgcc
tcccacgggaacggctacttcggctcccccttcctagacgtgatgggcatctccatccgg
ctcgccgaggacggctccgccctagtgagcggcgccttccaggagctgggcaacggcacc
atgaccgccatgacccagatagccgcccaggccctgtcgctgccggtggagagggtcttc
gtgagcgaggcggacacccatctgagccccttcgacgtgggctgcgtggccagccgggtc
acctacgtatgcggatccgcggtattggaggccgcaaggtccctcaaggacctcatggcg
gaggccttcctccgccttgcggggctggagggggacccgagccgggtccggttcgcggat
ggaaggctggagctggacgggacctccatgacctatcgggatctggccaccagggccctg
cgggagctgaagctggagctggcctcccatggaacccaccacccggtggacaaccccgca
tccttcggggtccacttcgcccaggtggaggtggacaccctcaccggcctggtgcgggtc
accgactacctggcctgtcacgacgtgggccgggccataaaccccaagctcctgcggggc
cagattctggggggggtccagatggggatcggcatggccctcagcgaggagctccggtac
gaccgatccggcaggcccctctgcggctccctgagccggtaccacatgcccaactgcccg
gacatgccggacgtgaaggtcctcctggtggaggagggggaggagggagggcccttcggg
gccaagagcattggggagatagccaccgtgccggtggcccccgccatatgcaacgcggtg
aacatggcgctgggcacctccatgacggagctgcccttcacccccgagaggatagtttcc
gccatgaatggagggaacgtacgatga

DBGET integrated database retrieval system