KEGG   Thermanaerovibrio acidaminovorans: Taci_1435Help
Entry
Taci_1435         CDS       T01129                                 

Definition
(RefSeq) pyruvate carboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00620  Pyruvate metabolism
tai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Taci_1435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tai02000]
    Taci_1435
Enzymes [BR:tai01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Taci_1435
Transporters [BR:tai02000]
 Other transporters
  Primary active transporters [TC:3]
   Taci_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-GeneID: 8631292
NCBI-ProteinID: YP_003317947
UniProt: D1B6M4
Position
complement(1488587..1490110)
Genome map
AA seq 507 aa AA seqDB search
MSQDRMSNDNGKRRAYVKVSEAPATAGESAAPKGCFRDPFAVGPRRIGITETAFRDAHQS
IMATRLRTEDMIPIAEAMDQVGYHSMEVWGGATFDACMRFLDEDPWERLRELRRRMPNTK
LQMLLRGQNLVGYRHYADDVVREFVKRAVGNGIDIIRIFDALNDLRNMEVAADQVKREGA
HLQLAISYTISPVHTLESFVKQAEDMVSMGADSICIKDMAGLLSPTEAGKLVSAIKSRIG
RVPLQVHSHYTSGFAAMTYLASIMAGADVVDCAISPFSMGTSQPATETMVAALAGGAFDT
GLSLEKLLPVAEHFSRLREKYSKLIMGVQGVDINILIYQVPGGMYSNLQSQLKEQGALHK
LREVLEEVPRVRKEMGYPPLVTPTSQIVGSQAAANVLVGERWKVVPKEVRQVFQGYYGRT
PAPVDPEIQRKVLGDEEPITCRPGELLEPELERAYREVEPWVLQPEDVLSYVLFPQVAKD
FLPRKYARSTLRDVGFEELREGAAYPV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcaggataggatgagcaatgacaacggtaagcgcagggcttacgttaaggtgtcc
gaggcgcccgctacggctggggagtcggcggcccccaaggggtgctttcgggatcccttt
gcggtcggtccccgcaggattggtataaccgagaccgccttccgggatgcccatcagtcc
ataatggccacccgtctcaggaccgaggacatgatccccatagcggaggccatggaccag
gtggggtaccactccatggaggtttgggggggcgccaccttcgatgcctgcatgcggttc
ctggacgaggatccctgggagaggctgcgggagctccgccgcaggatgcccaacaccaag
ctccagatgcttctgaggggccagaacctggtggggtaccggcactatgcggacgacgtg
gtcagggagttcgtgaagagggcggtgggtaacgggatagacatcataaggatcttcgac
gcccttaacgaccttaggaacatggaggtggcggcggaccaggtcaagcgggagggggct
cacctgcagctggccatctcctacaccatatcgccggtgcacaccctggagtccttcgtg
aagcaggcggaggatatggtctccatgggggcggactccatatgcataaaggacatggcg
gggcttctgtcccccaccgaggcggggaagctggtgtccgccataaagtcccggataggc
agggtgcccctgcaggtccatagccactacaccagcggcttcgccgccatgacgtacctg
gcgtccataatggccggggcggacgtggtggactgtgccatatcccccttctccatgggg
accagccagcccgccacggagaccatggtggccgccctggcgggaggggccttcgacacc
gggctatcgttggagaagctgttgccggtggcggagcacttctcgcgtctcagggagaag
tactcgaagctcatcatgggggttcagggggtagatataaacatcctgatctaccaggtg
cccggtggcatgtactccaacctgcagagccagctcaaggagcagggggcgcttcacaag
ctgagggaggtgctggaggaggtgccccgggtcaggaaggagatgggctatcctcctctg
gtgacccccacgagccagatagtgggtagccaggcggcggccaacgtgctggtgggggag
aggtggaaggtggtacccaaggaggtccgccaggtctttcagggctactacggccgcacc
cctgcgccggtggacccggagatccagcggaaggtgcttggggacgaggagcccatcacc
tgccgtcccggggagctcctggagcccgagctggagagggcctaccgggaggtggagccc
tgggtgcttcagcccgaggatgtgctgtcctacgtgctgttcccccaggtggccaaggac
ttcctgccccggaagtacgcccggtccaccctgagggacgtgggcttcgaggagctccgg
gagggggccgcctacccggtgtag

DBGET integrated database retrieval system