KEGG   Thermanaerovibrio acidaminovorans: Taci_1535Help
Entry
Taci_1535         CDS       T01129                                 

Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tai  Thermanaerovibrio acidaminovorans
Pathway
tai00260  Glycine, serine and threonine metabolism
tai01100  Metabolic pathways
tai01110  Biosynthesis of secondary metabolites
tai01120  Microbial metabolism in diverse environments
tai01130  Biosynthesis of antibiotics
tai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Taci_1535
Enzymes [BR:tai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Taci_1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 8631402
NCBI-ProteinID: YP_003318038
UniProt: D1B6W5
Position
complement(1602690..1603718)
Genome map
AA seq 342 aa AA seqDB search
MIDFRSDTVTKPSDEMRRAMAAAEVGDDVYGEDPTVRRLEEMGAQMLGTQDALFVCSGTM
GNLLAVLTWCGRGTSALVGRGSHVYSFEAGGMAALGGVMPVVLDDSSGAPSEEEVLSSVP
LRGNVHFAPGRLLCLEDTHNSRGGLALGPDRLRAPSGAARSLGLKVHLDGARLFNAALAV
GCSPSDYGAVADSIMVCLSKGLGAPMGSLLCGPADFVREARHWRKRVGGGLRQAGVVAAA
GIVALGQWGRLEEDHRKAQLLADMLEEGGLGVQRVPCPTNMVYLELPPHVRREEFVSNLA
RQGVLVSPSPDGRIRLVTHRDVSWDQVVQGARLVLKEAGFGS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttcaggagcgacacggttaccaagcccagcgacgagatgcgccgggccatg
gcggcggcggaggtgggtgacgacgtctacggggaggaccccacggtccgccggttggag
gagatgggggcccagatgctgggtacccaggacgccctcttcgtgtgctccggcaccatg
gggaacctgctggcggtcctcacctggtgcggccggggcacctccgccctggtggggcgc
ggttcccacgtctacagcttcgaggcggggggcatggcggccctgggaggggtgatgccc
gtggtgcttgatgactcgtccggggccccgtcggaggaggaggttctaagttccgtcccc
cttagggggaacgtgcacttcgctcccgggcggttgctctgcctggaggacacccacaac
tcccgcggggggcttgccttggggcctgatcggctgagggccccctccggggctgccagg
tccctggggctcaaggtgcacctggacggggcccggctcttcaacgccgccctagcggtg
gggtgtagtccctcggattacggggcggtggcggactccataatggtttgcctctccaag
gggctgggggcccccatggggtccctcctgtgcggcccagcggatttcgtccgggaggcc
cggcactggaggaagcgggttgggggaggcctccggcaggcgggtgtggtggccgccgcg
gggatagtggcgttgggccagtgggggaggctggaggaggatcaccggaaggcccagctg
ctcgccgatatgctggaggaggggggacttggggtccagcgggtgccgtgtcctaccaac
atggtctacctggagcttccccctcatgtccggcgggaggagttcgtgtccaacctggcc
cgtcagggggtgctggtatccccctccccggatgggaggataaggctggtgacccaccgg
gacgtgtcctgggaccaggtggtccagggggcacggctggtgttgaaggaggcggggttt
ggaagttga

DBGET integrated database retrieval system