KEGG   Tamlana sp. UJ94: C1A40_09700Help
Entry
C1A40_09700       CDS       T05295                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
taj  Tamlana sp. UJ94
Pathway
taj00860  Porphyrin and chlorophyll metabolism
taj01100  Metabolic pathways
taj01110  Biosynthesis of secondary metabolites
taj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:taj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C1A40_09700
Enzymes [BR:taj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     C1A40_09700
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     C1A40_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Sedlin_N Shikimate_DH K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AUS05722
UniProt: A0A2I7SII8
Position
2192912..2193490
Genome map
AA seq 192 aa AA seqDB search
MEERNNLYPIFLKAKSLNILIVGGGYVAEEKLTFLLKSSPDAHVTMVSKMFREETIALAK
KGDVTLIKDKYKKKYLKGQHIVVATTDKPKVNIKVHKHCRAKSLLVNVADNPPYCDFYMG
GIVTKGNVKVAISTNGKSPTTAKRLRQFFEDVIPENVDDLVKNLNEYRKTIKGDFEQKVE
KLNEFTKGLIEK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaagaaacaacctgtatccaatattcttaaaagctaaaagtttaaatattctt
attgttggtggtggttatgtggccgaagagaaattaacttttctgttaaaatcaagtccc
gatgcccatgtgacaatggtgtctaaaatgtttcgcgaagaaaccatagccctagcgaaa
aaaggtgatgttaccttaattaaagataagtacaagaaaaaatatttaaaaggtcaacat
attgttgttgcaacaaccgataagcctaaagtaaatattaaagttcataaacactgtaga
gcaaaaagcttgttggtaaacgtagccgataatccgccttattgcgatttttatatgggt
ggtatcgtgactaaaggaaatgtgaaagttgcgatttcaaccaatggaaagtcgccaaca
acagcaaaacgtttacgccagttttttgaagatgtcatccccgaaaatgtagatgattta
gtgaagaacttaaatgaatatagaaaaactataaaaggtgatttcgaacaaaaggttgaa
aaacttaacgagttcactaaaggattaattgaaaaataa

DBGET integrated database retrieval system