KEGG   Tamlana sp. UJ94: C1A40_09735Help
Entry
C1A40_09735       CDS       T05295                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
taj  Tamlana sp. UJ94
Pathway
taj00670  One carbon pool by folate
taj01100  Metabolic pathways
taj01120  Microbial metabolism in diverse environments
taj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:taj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C1A40_09735 (metF)
Enzymes [BR:taj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     C1A40_09735 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AUS05728
UniProt: A0A2I7SIK3
Position
2201432..2202388
Genome map
AA seq 318 aa AA seqDB search
MKVTDHIKKANGKTLFSFEVIPPQKGKNIQDLYNNIDPLMEFNPPFIDVTTSREEYVYVD
RGNGLLDKRITRMRPGTVGICASIMHKYKVDAIPHLLCGGFTKEETEYVLVDCHYLGIDN
VVALRGDARKDESYFVPTEGGNAYASELVQQISNLNKGQYLHDDIKVEHNYDFCVGVAGY
PEKHMESPSLNTDLKRLKAKVDAGADYVVTQMFFDNKKYFEFLDKARTIGITVPIIPGIK
PIAVKRHLQILPQVFKIDLPEELIEAVEGCKDNKAVREVGIEFAIQQSKELRDAGVPFLH
YYSMGKSDNIKAIASALF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacagatcacattaaaaaagcaaacggaaaaacattattttcttttgaagtt
attccgcctcaaaaaggaaaaaacattcaagatttatacaataatatcgatccgttaatg
gagtttaatccgccatttatagacgtcacaacttctagagaagaatatgtgtatgtcgat
agagggaatggtttattggacaagcgcatcacgcgtatgcgtccgggaaccgttggtatt
tgtgcgtctatcatgcataaatataaggtggatgctattccgcacttgctttgtggtgga
tttactaaagaagaaaccgaatatgtgttagtcgattgccattatttaggcattgataat
gtggtggctttacgtggtgatgccagaaaagacgaatcgtatttcgtgccaaccgagggc
ggaaacgcctatgctagcgaattggttcagcaaatttcaaatttgaataaaggccagtat
ttacatgacgatattaaggtagagcacaattacgatttttgtgtgggtgtagcaggttat
cctgaaaaacacatggaatcaccatcgttaaataccgatttaaaacgcttaaaagctaag
gtagatgcgggagcggattacgtggtgacccaaatgttttttgataataaaaagtacttt
gagtttttagataaggcgcgtaccattggtattacagtacctattattccggggattaaa
cctattgccgtaaaacgtcatttacaaattttacctcaagtttttaaaattgacttacca
gaagaattaattgaggctgttgaaggctgtaaagacaacaaggctgtacgtgaagtaggg
attgaattcgctattcagcagtctaaagaattaagagatgcaggtgtgccatttttacac
tattattctatgggtaagagcgacaacataaaggcgattgcctctgcattgttttaa

DBGET integrated database retrieval system