KEGG   Thauera aromatica: Tharo_1149Help
Entry
Tharo_1149        CDS       T05381                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tak  Thauera aromatica
Pathway
tak00620  Pyruvate metabolism
tak00630  Glyoxylate and dicarboxylate metabolism
tak01100  Metabolic pathways
tak01110  Biosynthesis of secondary metabolites
tak01120  Microbial metabolism in diverse environments
tak01200  Carbon metabolism
Module
tak_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tharo_1149
   00630 Glyoxylate and dicarboxylate metabolism
    Tharo_1149
Enzymes [BR:tak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tharo_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AVR88086
UniProt: A0A2R4BL82
Position
1213249..1215432
Genome map
AA seq 727 aa AA seqDB search
MTERVTCQRLQVAANLKRFIEEEALPGSGVDAVAFWSGFDALIHELAPKNRALLAERDRL
QGEIDAWHRAHPGPIADMAAYRAFLESIGYLLPVPADARITTTNVDDELALQAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDAIPQTDGAGLTAGYNPVRGAKVIAFGRRLLDQAA
PLAGASHADATAYAVAGGKLVVTLNNGSTTGLQQADKFAGYQGEAAAPKAVLLRNNGLHI
EIQIDRAGAIGKGDGAGVNDLLLEAAVSTIMDCEDSVAAVDAEDKLVVYRNWLGLMAGTL
EDTFEKGGKPMTRRLNPDREYTGADGKALKLHGRSLLFVRNVGHLMTNPAILDGVGNEVP
EGIMDAVVTTLIAKRDLERKGNSRRGSIYIVKPKMHGPAEIAFADELFTRVEQLLGLPAH
TVKLGIMDEERRTSVNLAACIAAAPARVAFINTGFLDRTGDEMHTAMEAGPMMRKGEIKN
SKWIAAYERRNVLIGLAAGLRGRAQIGKGMWAMPDLMAAMLEQKVNHPKSGANTAWVPSP
TAATLHALHYHQVSVAAVQQEIEKLDLNREAAALLDDLLTVPVVAKAGWSAAERQQELDN
NCQGILGYVVRWVEQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGVVGAEEVEQ
ALRRMAAVVDGQNAGDPAYRPMAPNFDDSVAFQAARALIFEGCTQPSGYTEPLLHRYRQQ
FKAKVGG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgagtgacgtgtcagcgccttcaggtcgctgcaaacctgaagcgtttcatt
gaagaagaagccctgcccggcagcggtgtcgatgcggtagcgttctggtccggtttcgat
gcactgatccacgagctggcgccgaagaaccgcgccctgctcgccgagcgcgaccgcctg
cagggcgagatcgatgcctggcaccgtgcccaccccggcccgatcgccgacatggcggcc
tatcgcgccttcctcgaatcgatcggctatctgctgcccgtgccggccgatgccaggatc
acgaccaccaacgtcgatgacgaactcgcgctgcaggccggcccgcagctggtggtgccg
gtgatgaacgcacgttacgcgctcaacgccgccaatgcgcgctggggctcgctgtacgat
gcgctgtacggcaccgatgcgattccgcagaccgacggcgccggactgaccgccggctac
aatccggtgcgcggggcgaaggtcatcgccttcggccgccggctgctcgaccaggccgcg
ccgctcgccggggcttcgcacgccgacgcgaccgcctacgccgtggccggcggcaagctc
gtggtgacgctgaacaacggcagcaccaccgggctgcagcaggcggacaagttcgccggc
taccagggcgaagccgcggcgccgaaagcggtgctgctgaggaacaacggcctccacatc
gagatccagatcgaccgcgccggtgcgatcggcaagggcgacggcgccggggtgaacgac
ctcctgctcgaagccgcggtgtcgacgatcatggactgcgaggactcggtcgccgcggtc
gatgccgaggacaagctcgtcgtctatcgcaactggctcgggctgatggccggcaccctc
gaggacacgttcgagaaaggcggcaagccgatgacccgccgcctcaaccccgaccgtgaa
tacaccggcgccgatggcaaggcgctcaagctgcacgggcgctcgctgctgttcgtgcgc
aacgtcggccacctgatgaccaacccggcgatcctcgacggcgtcggcaacgaagtgccc
gaaggcatcatggacgcggtggtgacgacgctgatcgccaagcgcgacctcgaacgcaag
ggcaactcgcgccgcggcagcatctacatcgtcaagcccaagatgcacggcccggccgaa
atcgccttcgccgacgagctgttcacccgcgtcgagcagctgctcggcctgcccgcccac
accgtcaagctcggcatcatggacgaggagcgccgcaccagcgtcaacctggccgcctgc
atcgccgccgcgccggcccgcgtggccttcatcaacaccggcttcctcgatcgcaccggc
gacgagatgcacaccgcgatggaagccggcccgatgatgcgcaagggcgagatcaagaac
agcaagtggatcgccgcctacgagcgccgtaacgtgctgatcgggctcgccgccgggctg
cgcggccgcgcccagatcggcaaggggatgtgggcgatgcccgacctgatggcggcgatg
ctcgagcagaaggtgaaccatccgaagtcgggcgcgaacaccgcctgggtgccgtcgccg
accgcggcgaccctgcatgcgctgcactatcaccaggtcagcgtggctgcggtgcagcag
gagatcgagaagctcgacctgaaccgggaggccgccgcgctgctcgacgacctgctcacc
gttccggtggtggcgaaggccgggtggagcgccgccgagcgccagcaggaactcgacaac
aactgccagggcatcctcggctacgtggtgcgctgggtcgagcagggcgtgggctgctcc
aaagtgcccgacatcaacgacgtcggcctgatggaagaccgcgccaccctgcgcatctcc
agccagcacatcgccaactggctgcgccatggcgtggtcggcgccgaggaagtcgaacag
gccctgcgccggatggctgcggtggtcgatgggcagaacgccggtgacccggcttaccgc
ccgatggcgccgaatttcgacgattcggtggccttccaggccgcgcgcgcgctgatcttc
gaaggctgcacccagcccagcggctacaccgagccgctgctgcaccgctaccgtcagcag
ttcaaggccaaggtcggcggctga

DBGET integrated database retrieval system