KEGG   Thauera aromatica: Tharo_1524Help
Entry
Tharo_1524        CDS       T05381                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
tak  Thauera aromatica
Pathway
tak00740  Riboflavin metabolism
tak00790  Folate biosynthesis
tak01100  Metabolic pathways
tak01110  Biosynthesis of secondary metabolites
tak02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Tharo_1524
   00790 Folate biosynthesis
    Tharo_1524
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tharo_1524
Enzymes [BR:tak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Tharo_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AVR88448
UniProt: A0A2R4BM92
Position
complement(1629449..1630606)
Genome map
AA seq 385 aa AA seqDB search
MRQAERAIFDLRRGLPILLRDTDRSVLVQAVEGLSDDALAALQALAGSTAQLVLSRHRMA
ALGRTVDGDAQALAFESLPACEALRELAWTRGARLPAASTARPAERCEDAAVRLLARAQL
VPAAIACPVLPARAAAAAAEVADGTLLAVDVSEALRLCQSGSGQLTRVSEARVPLSEADD
SRFILFREADGMHEHVAIVIGERARWPDAVPVRLHSSCLTGDLFGSLRCDCGEQLRRGVA
AIRAQGGGVLLYLTQEGRGIGLANKLRAYGLQDEGLDTIDADQVIGFSKDERTYRVAHEM
LEALGIPKVLLLTNNPGKVEALQRAGINVVARQAIYGAVTAQNQRYLHTKANRHGHWLHD
LLNEQGEPASDEPERLPAPGRAPSP
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaagccgagcgtgcaattttcgacctgcgacgcggccttcccattctgttgcgc
gacaccgaccgcagcgtcctcgtccaggcggtcgaaggtctgagcgacgacgccctcgcc
gcgctccaggcacttgccgggtcgaccgcacagctggtgctcagccgccaccgcatggcc
gctctggggcggacggtagacggcgacgctcaggcgctcgccttcgaatccctgcccgcg
tgcgaggcgctgcgcgagctggcgtggacacgcggtgcccgcctgcctgcggcatccacg
gcgagaccggcggagcgctgcgaggacgccgcagtccgcctgctcgcccgcgcccagctg
gtgccggcagcgatcgcctgcccggttttgccggcacgggcggcggcggccgccgctgaa
gtcgccgacggcacgctgctcgcggtcgatgtcagcgaagccttgcgcctgtgccagagc
ggctccggtcagctcacgcgggtgagcgaagcgcgtgtgccgctgtccgaggctgacgac
agccgcttcattctctttcgcgaagccgacggcatgcacgagcatgtcgccatcgtcatc
ggcgagcgcgcacgatggccggatgcggtaccggtgcgcctgcattcgtcctgtctgacc
ggcgacctcttcggcagcctgcgctgcgactgcggcgaacagctgcgccgcggagtggcc
gcgatccgtgcccagggcggcggcgtcctgctgtatctgacccaggaggggcgcggcatc
ggcctcgccaacaagctgcgcgcctacggtctgcaggacgaaggactggacaccatcgac
gccgaccaggtgatcggcttttccaaggacgagcgcacctaccgcgtcgcccacgagatg
ctcgaagcactcggcatccccaaggtgctgctgctgaccaacaacccgggcaaggtcgag
gcgctccagcgcgccggcatcaacgtcgtcgcccgccaggcgatctacggcgcagtgacg
gcgcagaaccagcgctatctgcacaccaaggccaaccgccacggccactggctgcacgac
ctgctcaacgagcagggcgaaccggcctccgacgaacccgaacgcctccccgcccccggc
cgggcaccaagcccctga

DBGET integrated database retrieval system