KEGG   Thauera aromatica: Tharo_1856
Entry
Tharo_1856        CDS       T05381                                 

Definition
(GenBank) Heavy metal RND efflux outer membrane protein, CzcC family
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
tak  Thauera aromatica
Brite
KEGG Orthology (KO) [BR:tak00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tak02000]
    Tharo_1856
Transporters [BR:tak02000]
 Other transporters
  Pores ion channels [TC:1]
   Tharo_1856
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: AVR88763
UniProt: A0A2R4BNK1
Position
1979125..1980390
AA seq 421 aa
MFRRIGINWLPGLLLGLAASGAWAQAASPASPVVTTLRQAFDAAWARQPEAQSLDMRRAA
ALARRVSVDRWSAEPPALEVSGKTDQLHRNDGSREYEIGLAVPLWLPGERASTAALADAE
VRASTSRTLAAQLRTAAGVRAAYWDWQRARVDVLVARERLASARELAADVSKRVRAGELA
RADQHQADGALATAEASLAEASGALAGAEQQLRALTGMTPALAAEGLSVAEAEPAPAAPP
VALGAGHPAIAELRDRAELAQRSMTLAGIQGRANPELNLATTRERGASGESWQQTVTIGV
RIPFGSDSRNRARVASASAEAIEAETQLRLERERLTAEVDTARVRVESARTLVASAEQRA
QLARESRGFFQKAFRLGETDLPTRLRIELEATEAERQVARTRIELAAAVSALRQAMGLLP
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtttcgaagaattggcatcaactggctgccgggcctgctgctcggactcgcggccagc
ggggcgtgggcgcaagccgcgtcccctgcatcgcctgtcgtaacgacgctcaggcaggcg
ttcgacgccgcgtgggcgcgtcagcccgaggcgcagtcgctcgacatgcgccgggcggct
gcgctggcgcgacgcgtgagcgtcgaccgctggtcggccgagccgccggcgctcgaagtg
tcgggcaagaccgaccaactccaccgcaacgacggcagccgcgaatacgagatcggcctc
gctgtgccgctgtggttgcccggcgaacgcgcatcgaccgcagcccttgccgatgccgaa
gtgcgtgcgagtacgagccgcacgcttgcggcacaactgcgcacggccgccggggtgcgg
gccgcgtactgggattggcagcgtgcgcgggtcgacgtcctggtcgcccgcgagcggctt
gccagtgctcgcgaactcgcagcggatgtgtcgaaacgggttcgggccggcgaactcgca
cgcgccgaccagcatcaggcggacggagcgctggcgaccgccgaagcgtcgctcgccgaa
gccagcggcgcgctcgcgggtgcggaacagcagttgcgcgccctgacaggcatgacacca
gcgcttgccgcggaaggactttccgtggccgaagccgaacccgcccccgccgccccccct
gtcgccctgggggcggggcatccggccatcgccgagctgcgcgatcgggcggagctggca
cagcgcagcatgactctcgccgggattcaggggcgcgccaatcccgagctgaacctggcg
acgacgcgtgagcgcggtgcatccggcgaatcctggcaacagacggtgacgatcggcgta
cgcattcccttcggatccgactcccgcaaccgcgcccgtgttgccagcgccagcgccgag
gcgatcgaagccgaaacccagctgaggctggaacgcgaacgcctgacggccgaagtggat
acggcgcgcgtccgcgtcgaatcggcgcgcaccctggtcgcctccgccgaacagcgcgcg
cagttggcccgcgagtcgcgcggcttcttccagaaggcgttccgcctcggcgaaaccgat
ctaccgacccgcctgcgcatcgaactcgaagccacggaagccgagcgccaggtggcgcgc
acccgcatcgaactggccgcggccgtgtccgcgctgcggcaggccatgggccttcttccc
gaatga

DBGET integrated database retrieval system