KEGG   Thauera aromatica: Tharo_2435Help
Entry
Tharo_2435        CDS       T05381                                 

Definition
(GenBank) Exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
tak  Thauera aromatica
Pathway
tak03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Tharo_2435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tak03400]
    Tharo_2435
Enzymes [BR:tak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tharo_2435
DNA repair and recombination proteins [BR:tak03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tharo_2435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AVR89332
UniProt: A0A2R4BQ40
Position
2590046..2593594
Genome map
AA seq 1182 aa AA seqDB search
MTYDTLPPGFIALHGNRIETLLDTVAAWMARHPLTPLEPEIVLVQSNGMAEWVKMALARQ
AGVCAATAVQLPGRFLWQTYRQVLGRGEVPARSPLDKTTLAWRLMRLLPDVVAEAGFEPI
AGYLGGNRTHDDAGRRFQLALRIADLYDQYQVHRSDWLDAWGEGRELMCNAEGVETALPP
DQRWQARLWQRVLEALTPAQRALTRPQLHERVLTRLEAMGGQGGVPPDIHLPRRVVLFGM
THVPLPTLQLLAALSRHTQVLLAIPNPCRFHWADIMDGREWLRIARRRQPLRNGRDLHSE
ALDAMHLHAHPLLAAWGRQARDFVRQLDAFDDAEATRERFPLSRLDLFDEDTPADASLLE
QVQHHIRDLRPLAEHPKPTIPTKDRSIVFHLAHSPVRELEILHDQLLKLLAEPPGGKPLR
PRDIVVMVPAIDDFAPAIRAVFGQYGRHDPRHIPFDIADLSARASSPLMTAIEWLLRIPH
DRCRLSDLTALLDVPAIAARFGIAEDALPRLTQWISGAGIRWGLDATHREGLGLGACGAQ
NTALFGLQRMLMGYAVGDTHRALEQPYADIEPYDEIGGLDAELAGAFAQLIERLLAWQSD
SCRVATPEQWAERLRALLADLVHATDDGDRQTLGALHDALEAWLDACDEAEFDAPLPLEV
AAEALLDALEWPALGKRFRAGGITFCTLMPMRAIPFEVVCLLGMNDGDYPRRSPRSDFDL
MALPGQQRPGDRARRDDDRQLMLEALLSARRVLYVSWCGHSVRDNTEQPPSVLVAQLRDY
LAAGWSPETVAERTTQHPLQPFSRRYFEPDSGLATYAREWRAAHVAVPGEEGAMHVAGTQ
PEIPPLAPFIPDPAVPLTIAELARFLRNPVKAFFRQRLGVIFDDPAEALPDAEVFGFDKL
EEHGLVEELAKAVVARMETWAPQALAHFALEPAIEQALARIGRAGRLPMAGVGARIRATL
GAAVLQLLHAWQQARTAHPVAVQRLPLRHTHRGVVLEDWLGQRFATTPDTGATLWIELNP
GRLLEGTRQDKVRAHKLLYAWVKCLLAAASEASDAGLLIGRDATLRIETMAPEAARATLA
TLLEAWQQGLSAPLPVALKTALAFVAERNAADAYEGNERSTGEGEEATLARCYPDFESLI
ADGQFESLARTLYAPLADWVGTHIEIIPHPEPTPAANQEALA
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgacacccttccccccggcttcatcgccttgcacggcaaccgcatcgagacg
ctgctcgacaccgttgccgcgtggatggcgcgacatccgctcacgccgctggaacccgag
atcgtgctcgtgcagagcaacggcatggccgaatgggtcaagatggccctggcccgccag
gccggcgtgtgtgccgcaaccgccgtgcagttgccgggccggttcttgtggcaaacctat
cgccaggtgctgggccgtggcgaagtacccgcgcgctcgccgctggacaagaccacgctc
gcctggcggttgatgcgtctgctccccgatgtcgtcgcggaagcgggattcgagccgatc
gcgggttacctcggcggcaatcgcacccatgatgatgccggccggcgtttccaactcgcg
ctgcgtattgcagatctgtatgaccagtaccaggtgcaccgctcggattggctcgacgcc
tggggtgaagggcgcgaattgatgtgcaatgccgagggggtcgagacagcgctaccgccc
gaccagcgctggcaggcgcgcctgtggcaaagggtgctcgaagcactcacgcccgcacaa
cgtgcgctgacgcgcccccagctgcatgagcgggtactgaccaggcttgaagcgatgggc
gggcaaggtggcgtccccccagacattcatcttccccgccgcgtcgtgctcttcggcatg
acccatgtgccgctaccgacgctgcagctgcttgctgcgctgtcccggcatacccaggtc
ctgctggccatccccaacccctgccgctttcactgggccgacatcatggacgggcgcgag
tggctgcgcattgcccgtcgccggcagccgctgcgcaacggtcgcgatctgcattccgaa
gcgctcgatgccatgcacctgcatgcacacccgctgctcgctgcgtggggccggcaggca
cgcgacttcgtgcggcagctcgacgcctttgatgacgcggaggcgactcgcgagcgtttt
ccgctctcgcgcctcgacctgttcgacgaagacacacccgcagacgcctcgctgctggaa
caggtccagcaccacatccgcgacctgcggcctcttgccgaacacccgaagcccacgatc
ccgaccaaggaccgctcgatcgtcttccacctcgcgcacagcccggtgcgcgagctcgag
atcctgcacgatcagctgctgaagctgctcgccgaaccgccgggtggcaaacctctgcgc
ccgcgcgacatcgtggtgatggtccccgcgatcgacgacttcgcgccagcgatccgcgcc
gtgttcgggcagtacggccgccatgatccgcgccatattcctttcgacatcgcggacctg
tcggcgcgggcaagcagtccgttgatgacggcgatcgaatggctgttgcgcatcccgcat
gaccgttgcaggttgtcggatctcaccgcgctgctcgacgtgcccgccatcgccgcccgc
ttcggcatcgccgaggacgcgctgccgcgcctgacgcagtggatcagcggcgccggtatt
cgctggggtctggacgcgacgcaccgcgaggggctgggccttggcgcttgcggcgcgcag
aacactgcgctcttcggcctgcagcgcatgttgatgggctacgccgtcggcgacacgcat
cgcgcactggagcagccctacgccgacatcgagccgtacgacgagattggcgggctcgat
gccgaactggccggtgcgttcgcacagctgatcgagcgcctgctggcctggcaatccgat
agttgccgcgttgcgacccctgaacaatgggccgaacgcctgcgtgccctcctcgccgat
cttgtgcatgccaccgatgacggcgaccgacagaccctcggcgcactgcatgacgcgctc
gaggcttggctcgacgcttgtgatgaggctgagttcgatgccccgctgccattggaggta
gcggccgaggcgttgctcgatgcgcttgagtggccggccttgggcaaacgctttcgcgcg
ggcggcatcaccttctgcacgctgatgcccatgcgcgcgatcccgttcgaggtggtgtgt
ctgctgggaatgaacgacggcgactacccgcgtcgcagccctcgcagcgatttcgacctg
atggcgcttccgggtcagcagcgcccgggcgaccgcgcccgacgcgacgacgatcgccag
ctgatgctcgaggccttgctgtcggcacgccgcgtgctgtacgtgagctggtgcggacat
agcgtgcgcgacaataccgaacagccgccctcggtgctggtcgcccagctgcgcgactac
cttgcggccggctggtcgcccgaaacagtggctgagcgcaccacccagcacccgctgcaa
ccgttcagccgacgctacttcgaaccggatagcggtctggcaacctacgcacgtgaatgg
cgtgcggcacacgtcgccgtgccaggtgaagaaggcgcgatgcacgtcgctggtacgcag
cccgagattccgccacttgcccctttcatccccgatccggccgtgccgctcaccatcgcc
gaactcgcgcgcttcctgcgcaatccggtcaaggcgttctttcgccaacggctgggcgtg
atcttcgatgaccctgccgaggcgctccccgacgctgaggtgttcgggttcgacaagctg
gaagagcatggtctggtcgaggaactggccaaggcggtggtcgcccggatggagacgtgg
gcaccgcaggcacttgcacactttgcactcgagcccgcgatcgaacaggcccttgcgcga
atcgggcgtgcaggccgcctgccgatggccggcgtgggcgcccggatccgtgccacgctg
ggcgcggccgtcctgcagcttctgcacgcctggcagcaggcgcgcaccgcacaccccgtt
gcggtccagcgcctccctctgcgtcatacgcacagaggcgtcgtactggaagactggctc
gggcagcgtttcgccaccacgcccgataccggcgccacgctgtggatcgagctgaacccg
ggccgccttcttgaaggcaccaggcaggacaaagtgcgcgcacacaaactgctgtacgcg
tgggtgaagtgtctgctcgcggccgcgtcggaagcctcggacgcgggcttgctgatcgga
cgcgacgccacgctgcgtatcgagacgatggccccggaagccgcccgcgcgaccctggct
acgttgctcgaggcctggcagcaaggcctgagtgcgccgctaccggtcgcgctcaagacc
gcgctcgccttcgtcgccgaacgcaacgcagccgatgcctacgaaggcaacgagcgcagc
accggtgaaggcgaagaggccacacttgcccgctgctatccggacttcgagtccttgatc
gccgacggccaattcgagtccctcgcacgaacgctctacgccccgctcgccgattgggtc
ggcacgcacatcgagatcattccccatcctgagcccacgccggccgcgaaccaggaggcg
ctcgcctga

DBGET integrated database retrieval system