KEGG   Thauera aromatica: Tharo_2920Help
Entry
Tharo_2920        CDS       T05381                                 

Definition
(GenBank) Pyruvate:Oxaloacetate transcarboxylase domain protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tak  Thauera aromatica
Pathway
tak00620  Pyruvate metabolism
tak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tharo_2920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tak02000]
    Tharo_2920
Enzymes [BR:tak01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Tharo_2920
Transporters [BR:tak02000]
 Other transporters
  Primary active transporters [TC:3]
   Tharo_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: AVR89801
UniProt: A0A2R4BR23
Position
3113777..3115264
Genome map
AA seq 495 aa AA seqDB search
MAHLQLIDTSIRDGNQSLWGATGLNTPQILSIAPILDRVGFRAINYASSTHMGMAIKTHR
EDPWERIRLTHAAMPNTPLEFIGTGLRFISWESQHPEFMQLVYDRLVINGISRFIVMDPM
NDAQAMLESAQMMRKAGGSEIIAALTYTISVVHDDAYYANFAAQLARSPNIDRLYIKDPA
GILTPERARTLIPAIQAQLGGKALELHSHCNIGLAPITYMTAAELGINALQVGCGALSSG
TAQPNAQRVVANLRELGHTVDVDDRALALVSNYFTRIAAAENLPVGMPQEFDAAFLRHQA
AGGYISTTRRQLAELKLEHRFDEVMEELSRVRAELGYPIMVTPFPQMLGSQAFYNVIGNE
RYANVSDQVIRYVLGNFGRPTGVIDPQVKDRILARPRAKELMNEPPPPTLAEMRRQFPPG
ISDEEFLLRATMPAEQVEAMLAAGPARRHYNPDVQPVLKLLRELQTRPGVSDIVIDKPNF
RLELHGNGSQENANA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcccatctccagctcatcgacacctcgatccgcgacggcaaccagagcctgtggggt
gcaaccgggctcaataccccgcagatcctgtcgatcgcgccgatcctcgaccgggtcggt
ttccgcgccatcaattacgcctcgagcacgcacatggggatggcgatcaagacccaccgc
gaagatccgtgggagcgcatccgcctgacccacgctgcgatgcccaacaccccgctggaa
ttcatcggcaccgggctacgcttcatctcctgggaaagccagcaccccgagttcatgcag
ctcgtatacgaccggctcgtcatcaacggcatttcgcgcttcatcgtcatggacccgatg
aacgatgcgcaggccatgctcgaatcggcgcagatgatgcgcaaggccggcggcagcgag
atcatcgccgccctgacctacaccatcagcgtcgtgcacgacgatgcctactacgccaac
ttcgccgcgcaactggcccgctcgcccaacatcgaccgcctctacatcaaggacccggcc
ggcatcctgacgcccgagcgggcgcgcacgctgatcccggcgatccaggcgcaactgggc
ggcaaggcgctggaactgcattcccattgcaacatcgggctggcgccgatcacctacatg
accgccgccgagctgggcatcaacgccctgcaggtcggctgcggcgcactgagcagcggc
acggcgcagccgaacgcgcagcgcgtcgtcgccaacctgcgcgaactgggccacacggtg
gacgtcgacgaccgcgcgctggccctggtgtcgaactacttcacccgcatcgccgccgcc
gagaacctgccggtgggcatgccccaggagttcgatgccgcgttcctgcgccaccaggcc
gcgggcggctacatctcgaccacccggcgccagctcgcggaattgaagctcgaacatcgc
ttcgacgaagtcatggaagagctgagccgggtgcgcgccgagctgggctatccgatcatg
gtcacgcccttcccccagatgctcggctcgcaggccttctacaacgtgatcggcaacgaa
cgctatgccaacgtctcggaccaggtgatccgctacgtgctcggcaatttcggccgcccg
accggcgtcatcgacccccaggtgaaggaccgcatcctggcccgcccgcgcgcgaaggag
ctcatgaacgagccgccgccgccgacgctggcggaaatgcgccgccagttcccacccggc
atttcggacgaagagttcctgctgcgcgcgacgatgccggcggaacaggtcgaggccatg
ctcgccgccggccctgcgcgccgccactacaaccccgacgtgcaaccggtgctgaagctg
ctgcgcgagctgcaaacccgcccgggcgtctccgacatcgtgatcgacaaacccaatttc
cgcctcgaactgcacggtaacggcagccaggagaacgccaatgcgtga

DBGET integrated database retrieval system