KEGG   Thauera aromatica: Tharo_3128Help
Entry
Tharo_3128        CDS       T05381                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
tak  Thauera aromatica
Brite
KEGG Orthology (KO) [BR:tak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tak03009]
    Tharo_3128
Enzymes [BR:tak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Tharo_3128
Ribosome biogenesis [BR:tak03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Tharo_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran Methyltransf_32 MTS
Motif
Other DBs
NCBI-ProteinID: AVR90009
UniProt: A0A2R4BRP6
Position
3363967..3364908
Genome map
AA seq 313 aa AA seqDB search
MITPFQALACPLDGEPLQRDGAAWRCAAGHSFDIARQGYTNLLPVQHKRSRDPGDSKEMV
AARHRFLDPGSGTGTEPCPPGPYQPLAAAVSRALLAGLAPGAAASCLDAGCGEGYYLRQL
AAAAGERHPLALLGLDISKWAVMAAAKQDKRANWVVGSNAGLPVQTGTLDRVLCMFGFPV
HAEFARVLRPGGELLLVDAGPDHLRELREIIYPALKPERPANPRAPDGFAALPAETVRYR
LELAGAAQIADLLAMTPHLYRASAAGRARAAALDALTVTVDVRLARFRRITASTAATSAG
TCAEAPTRASESR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcccttccaggccctggcctgccccctcgacggcgagcccctgcagcgcgac
ggcgccgcctggcgctgcgccgccggccacagcttcgacatcgcccgccagggctacacc
aacctgctgccggtgcagcacaaacgttcccgcgacccgggcgacagcaaggagatggtc
gccgcccgccaccgtttcctcgaccccggctccggcaccggcaccgagccttgcccgccc
ggcccttaccagccactcgcggctgcggtcagccgcgcgctgctcgccggcctcgccccc
ggcgccgccgccagctgcctcgacgccggctgcggcgaaggctactacctgcgccagctc
gccgccgcggccggggagcgccacccgctcgccctgctcgggctcgacatctcgaagtgg
gcggtgatggccgcggcgaagcaggacaaacgggcgaactgggtagtgggcagcaacgcc
ggcctgccggtgcaaacgggcaccctcgaccgggtgctgtgcatgttcggctttccggtc
cacgccgaattcgcccgcgtgctccggcccggcggcgaattgctgctggtcgatgccggg
cccgaccatctgcgcgagctgcgcgaaatcatctaccccgcgctgaagccggaacgccct
gcaaacccccgggcgccggacggctttgccgcgctgccggcggagaccgtccgctaccgc
ctcgagctcgccggcgcagcgcagatcgccgacctgctggcgatgacgccgcacctctac
cgcgccagcgccgccggccgcgcccgggccgcggcgctggacgcgctgacggtcaccgtg
gacgtgcgcctggcgcgcttccgccggatcactgcgtcaaccgccgctacgtcagcgggg
acatgcgccgaggcgccgacgcgagcgagcgagagccggtga

DBGET integrated database retrieval system