KEGG   Thauera aromatica: Tharo_3244Help
Entry
Tharo_3244        CDS       T05381                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase HldD
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
tak  Thauera aromatica
Pathway
tak00540  Lipopolysaccharide biosynthesis
tak01100  Metabolic pathways
Module
tak_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:tak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Tharo_3244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tak01005]
    Tharo_3244
Enzymes [BR:tak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Tharo_3244
Lipopolysaccharide biosynthesis proteins [BR:tak01005]
 Unusual sugar
  Tharo_3244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AVR90125
UniProt: A0A2R4BS04
Position
3483803..3484765
Genome map
AA seq 320 aa AA seqDB search
MIIVTGGAGFIGSNIVHGLNARGIRDILVVDDLSDGRKCLNLADADILDYVDKDDFLARI
QAGERFGQVDAVFHEGACSSTTEWDGRFVMKVNYEYTKALLAWCVADKVPLIYASSASVY
GMGPVFREGREFEQPLNMYAYSKFLFDCHLRPQLAGLGSQVVGLRYFNVYGPREQHKGGM
ASVAFHFHNQLRESGRVRLFEGSDGYGPGEQRRDFIHVDDIVAVNLWLLDNPQVSGIFNL
GTGRAQSFNDVAHAALRWMRARGQEGGGIDYIPFPEHLKGRYQSFTEADIGALRAAGYAR
PFMDVESGVPAYLDWLATRG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtcaccggcggcgccggcttcatcggcagcaacatcgtccacggcctcaac
gcccgcggcatccgcgacatcctcgtcgtcgacgatctcagcgacgggcgcaagtgcctg
aacctggccgacgccgatatcctcgactatgtggacaaggatgacttcctcgcccgcatc
caggccggcgagcgcttcggccaggtggacgcggtgttccacgaaggcgcctgctcatcg
accaccgagtgggacggccgcttcgtcatgaaggtgaactacgagtacaccaaggccctg
ctcgcctggtgcgtggcggacaaggtgccgctgatctacgcctcgtcggcctcggtgtac
ggcatggggccggtgttccgcgaggggcgcgagttcgagcagccgctgaacatgtacgcc
tactccaagttcctgttcgactgccacctgcgcccgcagctcgccggcctcggcagccag
gtcgtgggcctgcgctacttcaacgtctacggcccgcgcgagcagcacaagggcgggatg
gcgagcgtcgccttccatttccacaaccagctccgggaatccggccgggtgcgcctgttc
gagggctcggacggctacggcccgggcgagcagcggcgcgacttcatccatgtcgacgac
atcgtcgcggtgaacctgtggctgctcgacaacccccaggtgtcgggcatcttcaacctc
ggcaccgggcgcgcgcagagcttcaacgacgtcgcccacgccgcgctgcgctggatgcgc
gcccgcggccaggaaggcggcggcatcgactacatccccttccccgagcacctgaagggg
cgctaccagagcttcaccgaggccgacatcggcgccctgcgcgccgccggctacgcgcgc
ccgttcatggacgtggaaagcggcgtgcccgcctacctcgactggctcgccactcgtggc
tga

DBGET integrated database retrieval system