KEGG   Thermocrinis albus: Thal_0420Help
Entry
Thal_0420         CDS       T01179                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tal  Thermocrinis albus
Pathway
tal00030  Pentose phosphate pathway
tal01100  Metabolic pathways
tal01120  Microbial metabolism in diverse environments
tal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thal_0420
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Thal_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N PG_binding_1
Motif
Other DBs
NCBI-ProteinID: ADC89055
UniProt: D3SPG8
Position
complement(410622..412418)
Genome map
AA seq 598 aa AA seqDB search
MSYWKRYLLIDLTSRTTETYDISQDTVEKFLGGNGIGVYLLHKLTKRGVDPLSPHNPVII
NTGPANGTLVPMSSKFCVVSKSPQTNGFTKGFCGGTFGNELKYAGYDGVIIMGCSDEWVH
IHIEDDKVYFNPADYLKGCTTSFTQKMIREKFGRDVGCLVIGPAGENLVKYACLISDLRA
VGTGGMGAVLGYKKVKAISVRGTKLVRPVNPERLLTFVKEFEKAVYQHPGVKNLAMFGTA
AGVLHLQHLGALPSYNWQRETFDDAEKISGEALRSKVIKDVACMGCIVPCGKYTVGKETF
TVGPEYEGIFAMGTIIGNRDLDTLIDLDRLTDELGLGQIQAGGVVAWVMECYEKGLLSKD
DLDGLDMKFGNTESVARLLKKIAYREGIGDCLAEGSERASDILGVGRDFVMTVKGMEIAG
HSPRAVKTQAIGYAVSNRGPVHCDIRPGMEENNITPLGDPTNKGSVAKELAVWTSVVNSI
IYCLSAERVVGLKLNDSILNMVNALMDWHLDMSDLNIIGERIYTLERLFNIREGFSKNDD
TLPRRIREEATERGYITTDDELKSMIEEFYTAFGWDKDGVPTQETLKRLSLEEFIHDT
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgagctactggaagaggtacttactcatagatctaaccagtaggaccacagaaacctac
gatatatctcaagataccgtagagaaattcttaggaggtaatggtataggagtgtatctt
ctacacaaactcacaaagagaggtgtagatcctctctcaccacataatccggtaattata
aatacaggacctgctaacggaactcttgtacccatgtcgtccaagttctgtgtagtatcc
aaatcaccacaaactaatggcttcacaaagggcttttgtggaggtaccttcggtaatgaa
ctcaagtatgcaggatacgatggtgtgataattatgggatgcagtgatgaatgggttcat
atacacatagaagatgataaagtttactttaatcctgcagattacctgaagggatgtact
actagttttactcagaaaatgataagagaaaagtttggtagagatgttggttgtttggta
ataggccccgccggtgagaacttggtgaagtatgcgtgcttaatatcggatctaagggcc
gtaggaaccggtggcatgggtgcggtacttggttacaagaaggtcaaggctatatccgta
aggggtactaagcttgtgagacccgtaaatccagaaaggttgcttaccttcgttaaggag
tttgaaaaagctgtttatcaacatcctggagtgaagaatctcgcaatgtttggaactgcc
gctggcgtacttcatcttcaacatttgggagctttaccttcttataattggcaaagggag
acctttgatgatgcagaaaaaatcagtggagaagctttgaggagtaaagtcattaaggac
gtagcgtgtatgggatgtatagttccctgcggtaagtatacggtgggtaaagaaaccttc
acagtaggaccagagtacgaagggatctttgccatgggtaccataataggtaacagagat
ttagatacactcatagacttagatcgtttaacagatgagttagggttaggacagatacag
gcaggcggtgtggtagcttgggtaatggagtgttacgaaaaagggttgttaagtaaggat
gacttagacggtttggatatgaaatttgggaacacagagtcggtcgcacgtctgctgaaa
aagattgcatacagggaaggtataggtgattgtttagctgaaggatcagaaagagcctca
gatatactgggtgtggggagggattttgtaatgactgtaaagggtatggagatagcggga
cactctccacgtgcggtaaagacgcaagccataggttatgctgtgtccaacagaggacca
gttcactgtgatataaggccgggcatggaggagaacaacataacacctcttggagatcca
accaacaaaggatcagtggcaaaagagctggccgtgtggaccagtgtagtgaacagtata
atctactgtctgagcgcggagagggtggtgggtctcaagctgaacgacagcatactaaat
atggttaacgcattgatggactggcatttagacatgtctgatcttaatataataggagaa
cgtatatacacgctagaaagactgtttaacatacgcgaaggtttttctaagaatgatgat
acattacccagaagaataagagaagaggctacagaaagaggatacataacaacagatgat
gaactgaaaagtatgatagaagagttttacaccgcttttggatgggacaaagatggtgta
cctacacaggagactctaaagagactttctcttgaggagtttattcatgatacttga

DBGET integrated database retrieval system