KEGG   Thermocrinis albus: Thal_0525Help
Entry
Thal_0525         CDS       T01179                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
tal  Thermocrinis albus
Pathway
tal00670  One carbon pool by folate
tal00720  Carbon fixation pathways in prokaryotes
tal01100  Metabolic pathways
tal01120  Microbial metabolism in diverse environments
tal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tal00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Thal_0525
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Thal_0525
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Thal_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR PGP_phosphatase
Motif
Other DBs
NCBI-ProteinID: ADC89159
UniProt: D3SPS2
Position
complement(506681..507559)
Genome map
AA seq 292 aa AA seqDB search
MKIRDLLRKGFSISFEFFPPKTEEGEEELFETIRNLQSINPTFVSVTYGAGGSTREKTRR
VVERIHRETSLTVMAHLTCIAHTEEELTEILRGYREIGIENILALRGDRPKDNSATEKRG
CQYAYQLVRLIRTKFGDHFSVGVASYPEGHPESPNLEWEVRYFKMKVEEGADFSITQMFF
DNSYYYRFVELCRKEGIDIPIIPGIMPITNFRQIQRFASMCGASIPHHVVQRLEPYAHLP
QETMKVGVELAIKQCEDLIENGVPGLHFYTLNKSKATLLIYDAIKDRVPTKI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaagataagagacctgctcagaaaggggtttagcatatcctttgagttcttccctccc
aaaacagaggagggagaggaagaactctttgaaactataaggaacctccaaagcataaac
cccaccttcgtatcggtcacttacggtgcaggtggaagcacccgtgaaaaaacacgccga
gtggtagaaaggatacaccgagagacgagtctgacagtaatggcccatcttacttgcata
gctcacacggaggaggagcttacggagatactgagggggtacagagaaataggtatagag
aacattctggccctgaggggtgataggccaaaagataacagcgctaccgagaaaagaggg
tgccagtacgcttaccaacttgtgcgcctcataaggaccaagtttggagatcacttctct
gtgggagtggcctcctatccggaaggacaccccgagtctcccaacctggagtgggaggta
cgctactttaagatgaaagtggaagaaggtgctgacttttctataacccagatgttcttt
gacaactcctactactaccgatttgtggagctgtgcagaaaagaaggtatagacataccc
ataatacccggtataatgcccatcaccaacttccgacagatccagaggtttgccagcatg
tgtggtgccagcataccccaccatgtggtgcagaggttagaaccttatgcccaccttcct
caggaaactatgaaggtaggtgtggagctagccataaaacagtgtgaggatcttatagag
aacggtgtgcctggacttcacttttataccctcaacaagtctaaagccacccttctcata
tacgacgccataaaggaccgcgtacctaccaagatatga

DBGET integrated database retrieval system