KEGG   Thermocrinis albus: Thal_0660Help
Entry
Thal_0660         CDS       T01179                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tal  Thermocrinis albus
Pathway
tal00010  Glycolysis / Gluconeogenesis
tal00020  Citrate cycle (TCA cycle)
tal00620  Pyruvate metabolism
tal00633  Nitrotoluene degradation
tal00640  Propanoate metabolism
tal00650  Butanoate metabolism
tal00680  Methane metabolism
tal00720  Carbon fixation pathways in prokaryotes
tal01100  Metabolic pathways
tal01120  Microbial metabolism in diverse environments
tal01130  Biosynthesis of antibiotics
tal01200  Carbon metabolism
Module
tal_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
tal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0660
   00020 Citrate cycle (TCA cycle)
    Thal_0660
   00620 Pyruvate metabolism
    Thal_0660
   00640 Propanoate metabolism
    Thal_0660
   00650 Butanoate metabolism
    Thal_0660
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Thal_0660
   00680 Methane metabolism
    Thal_0660
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thal_0660
Enzymes [BR:tal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thal_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4_2 Fer4 Fer4_10 Fer4_9 Fer4_4 Fer4_6 Fer4_13 Fer4_7 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ADC89293
UniProt: D3SQ56
Position
complement(628232..628456)
Genome map
AA seq 74 aa AA seqDB search
MYYVADVKESDCAKYNCKQCVLFCPEPNTLMYHESKHVAWVNYARCKGCAICVYVCSDLL
KRNCIQMVMVTASD
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgtggctgatgtaaaggaaagtgattgtgccaaatacaactgcaagcagtgt
gttctgttctgtcctgaacccaacaccctaatgtaccatgagtctaagcacgtggcgtgg
gtcaactacgccaggtgcaaaggttgtgccatatgcgtttacgtttgctcagatcttctc
aagagaaactgtatccagatggttatggtaacagcttctgactga

DBGET integrated database retrieval system