KEGG   Thermocrinis albus: Thal_0824Help
Entry
Thal_0824         CDS       T01179                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tal  Thermocrinis albus
Pathway
tal00010  Glycolysis / Gluconeogenesis
tal00051  Fructose and mannose metabolism
tal00562  Inositol phosphate metabolism
tal01100  Metabolic pathways
tal01110  Biosynthesis of secondary metabolites
tal01120  Microbial metabolism in diverse environments
tal01130  Biosynthesis of antibiotics
tal01200  Carbon metabolism
tal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thal_0824
   00051 Fructose and mannose metabolism
    Thal_0824
   00562 Inositol phosphate metabolism
    Thal_0824
Enzymes [BR:tal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thal_0824
Exosome [BR:tal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thal_0824
  Exosomal proteins of bladder cancer cells
   Thal_0824
  Exosomal proteins of melanoma cells
   Thal_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC89457
UniProt: D3SL27
Position
782006..782752
Genome map
AA seq 248 aa AA seqDB search
MKLIAANWKMNKTQREAEEYVSKFLPLVKDVTKTEILLCPPFTSLCKVSQMLEGSNVKLG
AQNCHSEKKGAFTGEISTVMLKDLGVEYVIVGHSERRWIFGESDEIIHKKIVACLEEGLR
PILCVGERWEDREAGMTFKVIETQIKLALSGLDAFVSKIDIAYEPVWAIGTGNPATPEDA
QLVHRFIKDLVGPVRVLYGGSVNTSNAGDFLRMPDVDGLLVGTASLDPESFFQIIQASEN
HHQQEEGG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgatagctgccaactggaagatgaacaaaacacaacgggaggcggaggagtac
gtaagtaagttcttacctttggtgaaagatgtcaccaaaacagagatactcctctgccct
cccttcacatctctctgtaaagtctctcaaatgctggaaggatctaacgtaaaactgggt
gctcagaactgccattccgaaaaaaagggagcctttacgggagagatatctaccgtcatg
ctcaaggatctaggtgtggagtacgtaatagtggggcattccgaaaggcgttggatcttt
ggtgagtctgatgaaattatccacaagaaaatcgtggcctgtttggaggagggtctcaga
cctattctctgtgtaggtgaaaggtgggaggacagagaggcagggatgacctttaaagtt
atagagacgcagataaaactggctctaagcgggttggatgcttttgtttctaaaatagac
atagcttacgaacctgtctgggctatcggtacaggtaaccccgctacaccggaggatgcc
cagctggttcacagattcataaaggatctggtgggacctgtgagagtactgtacggtggt
agcgtgaacacttccaacgcaggtgattttctgaggatgccggacgtagatggtcttttg
gtgggtacagccagtttagaccccgaatcctttttccagatcatacaggcttctgagaac
catcatcaacaggaagaaggagggtaa

DBGET integrated database retrieval system