KEGG   Thermocrinis albus: Thal_1178Help
Entry
Thal_1178         CDS       T01179                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIA
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
tal  Thermocrinis albus
Pathway
tal00627  Aminobenzoate degradation
tal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Thal_1178
Enzymes [BR:tal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     Thal_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 UPF0180
Motif
Other DBs
NCBI-ProteinID: ADC89810
UniProt: D3SM30
Position
complement(1099429..1100217)
Genome map
AA seq 262 aa AA seqDB search
MRRKILLLDMDGVLVKDKALNPFPDTLPFLDFLRSEGIPFRVVSNNSTRPPSTLLEDLSK
KGINLKEDELITPLKILPVYLRELHCSRLLVIGSPLLAEFLVEEGFQVVEDQKVDAVVIG
QDRNINFTKLKLATSAVFLESAKIVPVNHSRIVRDDDGLYFPGAGSLAHMLAHACGYSQP
IPNLGKPSEEFMRLALSGMEGDEVYLVSDDLYTDLVGAKEQGIKTIFITTGKYSKEELTK
ANFEPHYVVDSLTELMELLKTL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggaagatcttacttcttgatatggacggagttctggtgaaggacaaagccctt
aatccttttcctgacacattgccctttttggacttcctgcgttccgaaggcatacccttt
cgggttgtttccaacaactccacacggccaccttccacccttctggaggacctcagtaag
aaggggataaacctcaaggaggacgaactgataacacccctaaagatactgcctgtatac
ctaagggagctacactgcagcaggctcttggtgataggttctcccttactggcagagttt
cttgtagaggaaggttttcaagtagtggaggatcaaaaagtagatgcggttgtgataggg
caagacaggaacattaactttaccaagttgaagctggctacctcggcggtcttcctagaa
tctgccaagatagtgcccgtcaatcatagcaggatagtgagagacgacgatggtctttat
tttccgggtgcaggttcgttggctcatatgttggcacacgcctgcggatactcacaacct
atacccaacttaggtaaaccttccgaagagttcatgaggctggctctcagtggtatggag
ggggatgaggtgtacttggtaagcgatgacctttacactgatctggtaggtgcgaaggaa
cagggaataaaaaccatctttataaccaccggcaagtactctaaggaggagcttacaaag
gccaactttgaacctcactacgttgtagattctctgacagaactcatggagctcttaaaa
actttatga

DBGET integrated database retrieval system