KEGG   Thermocrinis albus: Thal_1182Help
Entry
Thal_1182         CDS       T01179                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
tal  Thermocrinis albus
Pathway
tal00540  Lipopolysaccharide biosynthesis
tal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tal00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Thal_1182
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tal01005]
    Thal_1182
Enzymes [BR:tal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Thal_1182
Lipopolysaccharide biosynthesis proteins [BR:tal01005]
 Unusual sugar
  Thal_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NmrA
Motif
Other DBs
NCBI-ProteinID: ADC89814
UniProt: D3SM34
Position
complement(1101904..1102836)
Genome map
AA seq 310 aa AA seqDB search
MRVLVTGGAGFIGSNVAKAVERAYPEARVTVLDNFSSGHFKNLWGFGGDVITGDVTDLSL
WEYLKKNFRFEVVFHKAAITDTTVMDQALVMRTNADSLRYILDACSYWGAKLIYASSAAV
YGKTTPPMKEGKGEIPQNVYGFSKLIMDRIALRYLQTQTDIKVVGFRYFNVYGPGESFKG
KAASMVYQLYLQMKEGRRPRLFKWGEQKRDFVYIEDVVKANLLALEKDVSGVFNIATGKA
RSFNDIVGILNGLLGTNLEPDYFDCPYDFYQEHTEADISLAREILGYEPMFSLEDGIEDY
VKRLESGIIY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttggtaacgggtggagctggtttcataggctccaacgtagcgaaggctgta
gagagggcttatccagaggcacgggttacggtactggacaacttctcctcgggtcatttt
aaaaacctgtggggattcggcggagatgtgataacaggggatgtaacagatctctccctg
tgggagtatctgaagaagaactttaggtttgaagtggtctttcataaagctgccataacg
gacaccaccgttatggatcaggccctcgtcatgagaactaacgctgacagtcttaggtac
atactggatgcctgttcctactggggagctaagctcatctacgcttcttcggcagccgtt
tatggtaagaccacaccccctatgaaggagggaaaaggggagataccacagaacgtttac
ggcttttccaaactcatcatggacagaatagcgctcagatacttgcagacacagacagac
ataaaggtggtgggttttaggtactttaacgtttacggaccaggagagtcctttaaggga
aaggcagccagcatggtataccagttatatctacagatgaaggagggaagaaggcccagg
ctgtttaagtggggtgagcaaaagagggacttcgtgtacatagaagatgtggtgaaggcc
aacctcttggccctcgaaaaggatgtttcgggagtcttcaacatagccacagggaaggca
aggagttttaacgatatagttggcatactcaacggccttcttggaacaaatcttgagcct
gactactttgactgtccttacgacttttatcaggagcacacggaagcggatataagtctc
gccagagagatcctcggctatgagcctatgtttagcctagaggatgggatagaggattac
gttaaaaggttagaatcgggtataatatattaa

DBGET integrated database retrieval system