KEGG   Thermocrinis albus: Thal_1463Help
Entry
Thal_1463         CDS       T01179                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
tal  Thermocrinis albus
Pathway
tal00521  Streptomycin biosynthesis
tal00523  Polyketide sugar unit biosynthesis
tal00525  Acarbose and validamycin biosynthesis
tal01130  Biosynthesis of antibiotics
Module
tal_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Thal_1463
   01055 Biosynthesis of vancomycin group antibiotics
    Thal_1463
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thal_1463
   00525 Acarbose and validamycin biosynthesis
    Thal_1463
Enzymes [BR:tal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Thal_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind 3Beta_HSD NAD_binding_4 NAD_binding_10 adh_short KR adh_short_C2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADC90092
UniProt: D3SMW2
Position
complement(1366029..1366985)
Genome map
AA seq 318 aa AA seqDB search
MKLLITGGAGFIGSEFTRQAVKEGYQCVVVDKLTYAGDIRRLEEVLEKITFYRCDINNRE
FLEYIFSKEKPDVVVHWAAESHVDRSISDPSPFFTTNVLGTLNLLDTAKKYGVKSFINIS
TDEVYGELGDEGSFKEDSCLKPNSPYSVSKASADMLGRAYFRTYGLPVITVRPSNNYGPW
QYPEKLIPVVIVKAIKNEPIPIYGRGLNVREWLYVSDCAEAVLEIIKKGEPGEIYNVGSG
EERRNIEVAKLILSILGKPEDLISFVQDRPGHDYRYSLDVSGTWEKLGWKAKTKLEEGIR
RTVEWYLDHIDWALEKVT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctgataacaggaggtgcgggtttcataggcagcgaatttacccgtcaagcg
gtgaaagaaggttaccagtgcgtagtggtagataagctcacttacgcaggcgatataagg
agactggaggaggttttggagaagattaccttctacaggtgtgatatcaacaacagggag
tttttggagtacatattcagtaaagaaaagccggacgtggtggttcactgggcagcagaa
agccatgtagacagaagtatctcggatccctctccctttttcaccaccaacgttttgggt
acgctgaaccttctggatacagcaaagaaatacggcgttaaaagttttatcaacatatcc
accgacgaagtttacggtgagctgggtgatgaaggttcttttaaggaagattcatgcctc
aaacccaactcgccttactctgtttctaaagccagtgccgatatgctaggtagggcttac
tttagaacctacgggcttcctgttataacagtgagaccttccaacaactacggaccgtgg
cagtatccggaaaagctcatacctgtggtgatagtgaaagccatcaagaacgagcctata
cccatctatgggcgtggactcaacgtgagggaatggctttacgtaagtgactgtgcggag
gctgtccttgagatcatcaagaagggtgaacctggagaaatctacaacgtaggtagtgga
gaggaaagaagaaacatagaagtggccaagttgatactcagtatccttggaaaacctgag
gatcttatcagctttgtgcaggacagaccggggcatgattacagatactccctcgatgtt
tccggaacatgggagaagctcggctggaaggctaaaaccaagttggaagaaggcataaga
cgtacggtagagtggtacttagatcacatagactgggctctggaaaaggtaacatga

DBGET integrated database retrieval system