KEGG   Thermocrinis albus: Thal_1494Help
Entry
Thal_1494         CDS       T01179                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
tal  Thermocrinis albus
Pathway
tal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thal_1494
DNA repair and recombination proteins [BR:tal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Thal_1494
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Thal_1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 Toprim RecR PHF5
Motif
Other DBs
NCBI-ProteinID: ADC90123
UniProt: D3SMZ3
Position
complement(1396445..1397053)
Genome map
AA seq 202 aa AA seqDB search
MAYQEYIPPVLKRALEVLTYIPTYGERSASRFVYNFLKLSPEERDEILKTLFELSRSARK
CSECGLVSDTDPCRICSDTKRNKRFLCVVEESQDAYAIERLERYTGVYHVLGGRIAPLEG
ISAEDLNIEGLLRRIENYGVKEVILATNPNVEGEATANYILSLIKKRFPSVKVSRISHGL
QFGSLIELADDLSLERSIENRR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaggaatacataccgccggttttaaaaagggcgttggaggtgctaacttat
atacccacctacggcgagaggagtgcctctcgttttgtgtacaactttctaaaactgagc
ccagaggagcgtgatgagatcctaaagactctttttgaactctctcgatctgccagaaaa
tgcagcgagtgtggtcttgtatccgatacggatccgtgtaggatatgtagcgatactaag
agaaataagcgctttttgtgtgtggtagaggaatctcaggacgcttacgctatagagcgt
ctggagagatacacaggtgtgtatcacgttttgggagggaggatagcacccttggagggt
atctccgcagaggacctcaacatagaaggccttcttaggagaatagaaaactacggtgtg
aaggaggttatactggccacaaaccccaacgtggagggagaagcaacggccaactatatt
ctttccctcataaaaaaacgctttccttctgtcaaagttagccgtatatctcacggtctg
cagtttggatccctcatagagttggcagacgatctgtccttggaaagatccatagagaac
agacgctga

DBGET integrated database retrieval system