KEGG   Terriglobus albidus: FTW19_13520Help
Entry
FTW19_13520       CDS       T06135                                 

Definition
(GenBank) mandelate racemase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
talb  Terriglobus albidus
Pathway
talb00051  Fructose and mannose metabolism
talb01100  Metabolic pathways
talb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:talb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    FTW19_13520
Enzymes [BR:talb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     FTW19_13520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: QEE28928
UniProt: A0A5B9E9V3
Position
3431082..3432302
Genome map
AA seq 406 aa AA seqDB search
MYIETISSEDCRFKLEAGAGSDAVHSDPEYSFAVTKLTLDAGVTGTGLVLTMGRGNELVC
NAINLLSLPLAGRDIENLMSDFGRTFRVLADDAQLRWLGPHKGVVHLALASITNACFDAW
AKARRVPLWKLLLSLSPAEIVSLLDLSYLEDVLDTTSATELLTAQISSRRTREDVLTAGY
PGYDTSVGWYQYSSAQIEERVRRSVDAGFGAFKLKVGGSLDHDLSRARGLRQVAGDKATI
MFDANQQWNYPQALAACKELAALAPLWIEEPTHPDDVFAHKSLANAVAPVALALGEHVPN
RVIFKNFLQAECVKFLQPDCTRLGGVSEFLTVSLLARKFDVPVVPHVGDMGQIHQHLVLF
NHVAMGHPRTFLEYIPHLSTHFVNPAVVKDGRYQTPQEPGSSSDLI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgagacgatttcctccgaggactgccgcttcaagcttgaagcgggcgcaggc
tcggacgcagtgcactccgaccccgaatattcctttgctgtaacaaagctgactctcgat
gccggcgttactggaaccggactggtcctcaccatggggcggggcaatgagctggtgtgc
aacgcaatcaatcttctcagtctcccattggcaggccgggatattgaaaacctgatgtcg
gattttggccggacatttcgcgtgctggccgatgacgcacagcttcgctggctggggccg
cataaaggagttgttcatcttgcgcttgcttccatcaccaacgcatgttttgatgcctgg
gcgaaagcaagacgcgttccgctctggaagcttcttctctcgctctctccggctgaaatc
gtatctctactggatctcagctatctggaagatgtactcgacaccacctcagccacagag
ctactgacggcgcagatctcgtctcgtcgcacgagggaagatgttctgacggccggctat
ccgggctacgacacaagtgttggctggtaccaatacagttctgctcagattgaggagaga
gtccgtcgcagcgttgatgcgggctttggtgccttcaagctgaaagtcggcggatcgctc
gatcatgatctctcacgcgcacgaggattgcggcaggttgccggggataaggccaccatc
atgtttgacgcaaaccagcaatggaactatccgcaggctttagccgcctgcaaagagctt
gcagcgctagctccactttggattgaagaacccactcaccccgatgatgtcttcgctcac
aagtctttggcgaatgctgtagcgcccgtagcattagccctcggcgagcacgtccccaac
cgggtgatctttaaaaatttccttcaggcggaatgtgtcaaattcctgcaaccagactgc
acgcgcctgggaggagtgagcgagtttctaacggtaagcttgctggcaagaaaatttgat
gtgcctgtagtgcctcacgtgggcgatatggggcagattcatcagcacctcgtacttttc
aatcatgtggcgatgggacatccaaggacgtttctcgagtacattccccacttgagcacg
cactttgtgaatccggcggtagtcaaggatggacggtatcaaacaccacaagagcccgga
agtagcagcgacctgatatga

DBGET integrated database retrieval system