KEGG   Thermovibrio ammonificans: Theam_0290Help
Entry
Theam_0290        CDS       T01391                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00330  Arginine and proline metabolism
tam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Theam_0290
Enzymes [BR:tam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Theam_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADU96263
UniProt: E8T4C8
Position
260024..260824
Genome map
AA seq 266 aa AA seqDB search
MKFLCAKEKGKIAVVGAPYDSTTCFRPGARFGPDGIRNFSHNLEEFSPALNKTLEELQFC
DLGNVELPAPPEQMVEHLYSFVKEVELPVVLGGEHSVTYPVVKALKERYGSLTVIHFDAH
ADLRDEYSGTPYSHACVMRRVAELGCTVYQVGIRSGAREEFLYRETSPFVFDVELSELPT
LFSSLEEPVYITVDIDYFDPAYAPGTGTPEPGGASPLEFFTTLYKLPAVKLVGFDLVEVA
PPYDPSGITQALGAKVVREVMLKFWG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttcctctgtgccaaggaaaaaggaaagatagcagttgtcggtgcaccctacgac
tctaccacctgttttaggcctggggcccgtttcggtcccgacgggataaggaatttttcc
cacaaccttgaagagttcagtccggctctcaataaaaccctggaagagcttcagttctgt
gacctcggaaacgttgaacttcccgcccctcccgaacagatggttgaacacctctactcc
ttcgtgaaagaggtcgagcttcccgttgttctgggaggtgagcactctgtcacctaccct
gttgtaaaggcccttaaggagcgttacggttccctaaccgttatccactttgacgcccac
gccgacctcagggatgagtactccggaaccccttactcccacgcctgcgttatgagaagg
gtagcagagcttggatgtaccgtttaccaagttgggataaggagcggagcccgggaggag
ttcctctacagggagacctcccccttcgtcttcgatgtggagctttcagagcttcccacc
ctcttcagctccctcgaggagcccgtttacataaccgttgatatagactacttcgacccg
gcttacgcacccggaaccggcactcccgagcccggcggagcttcaccgcttgaattcttc
accaccctttataaattaccagccgtcaagctggtagggttcgaccttgtagaggtggca
cctccctacgacccctccggaatcacccaggccctcggggccaaagtggtcagggaggtg
atgctcaagttctgggggtga

DBGET integrated database retrieval system