KEGG   Theileria annulata: TA06210Help
Entry
TA06210           CDS       T00253                                 

Definition
(RefSeq) cytochrome C1 heme lyase, putative
  KO
K01764  cytochrome c heme-lyase [EC:4.4.1.17]
Organism
tan  Theileria annulata
Pathway
tan00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TA06210
Enzymes [BR:tan01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.17  holocytochrome-c synthase
     TA06210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyto_heme_lyase
Motif
Other DBs
NCBI-GeneID: 3863712
NCBI-ProteinID: XP_953889
GeneDB: TA06210
UniProt: Q4UI78
Position
1
AA seq 194 aa AA seqDB search
MSCPSSNDTGSYCSSKNHIGPRISPDPVALSKLCSKRSKSSIPSRDSLWSYPSQQQFYKS
TLNKGHNVDSNLIPTIVEIHNLVNEKAWERVMEYESVHKETCKNPVLVHFVGNKDKHTFK
SILNYISGYKLPFDRHDWTVDRCGNRRRYILEFYEGSTDDPNKLGVHIDVRPDLSFNGIC
DRLRFWVHKSFSGI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcccctcatcaaatgataccgggtcgtattgttcttccaaaaatcatattggt
ccaagaatttcaccggatcctgttgcactttctaagctatgctcaaagaggtcaaaatct
tctattccttccagagattctctttggtcttatccttcacaacagcaattctacaaatca
accctaaataagggtcacaatgttgactctaatttgattcccacaatagttgaaattcac
aacttggttaatgaaaaggcatgggaacgtgttatggaatatgaatcagttcacaaagaa
acttgcaaaaatccagttctcgttcatttcgttggaaataaggataaacatacttttaaa
tcaattttaaattatatatctggttacaaattaccatttgacaggcacgactggactgtt
gataggtgtggcaatcgcagaagatacattttggaattttatgaaggctctactgatgat
cctaataaactgggtgtgcacatcgatgttaggcctgatctttccttcaacgggatttgt
gatagactcagattctgggttcacaaatcttttagtggtatataa

DBGET integrated database retrieval system