KEGG   Theileria annulata: TA07290Help
Entry
TA07290           CDS       T00253                                 

Definition
(RefSeq) histone H2B (variant 1), putative
  KO
K11252  histone H2B
Organism
tan  Theileria annulata
Brite
Chromosome and associated proteins [BR:tan03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    TA07290
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TA07290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone TFIID_20kDa CBFD_NFYB_HMF YscO-like
Motif
Other DBs
NCBI-GeneID: 3862730
NCBI-ProteinID: XP_952763
GeneDB: TA07290
UniProt: Q4UAL4
Position
4
AA seq 123 aa AA seqDB search
MSGKVPSSKSHAAKKTAGKTLGVRYRRKKRVESFSLYIYKVLKQVHPETGVSKKSMSIMN
SFINDVFDRLALEATRLIRYNKKSTLSSREVQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGV
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagtaccatcatcaaaatctcatgccgctaagaaaactgctggaaaaact
cttggagtaagataccgtaggaagaagcgtgttgagtcattttcactttacatatacaag
gtcttgaaacaggtgcaccctgaaactggtgtgagtaagaagagcatgagcatcatgaac
tcctttatcaatgatgtattcgaccgtcttgcacttgaagctactagactcattaggtat
aataagaaaagcacacttagctctcgtgaagtacaaactgctgtaagacttcttctacca
ggtgaactttcaaaacatgccgtatcagaaggaactaaagccgttactaaatacactaca
tctggagtctaa

DBGET integrated database retrieval system