KEGG   Theileria annulata: TA08590Help
Entry
TA08590           CDS       T00253                                 

Definition
(RefSeq) triosephosphate isomerase, putative
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tan  Theileria annulata
Pathway
tan00010  Glycolysis / Gluconeogenesis
tan00051  Fructose and mannose metabolism
tan00562  Inositol phosphate metabolism
tan01100  Metabolic pathways
tan01110  Biosynthesis of secondary metabolites
tan01130  Biosynthesis of antibiotics
tan01200  Carbon metabolism
tan01230  Biosynthesis of amino acids
Module
tan_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TA08590
   00051 Fructose and mannose metabolism
    TA08590
   00562 Inositol phosphate metabolism
    TA08590
Enzymes [BR:tan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TA08590
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TA08590
  Exosomal proteins of bladder cancer cells
   TA08590
  Exosomal proteins of melanoma cells
   TA08590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC Phosphonate-bd
Motif
Other DBs
NCBI-GeneID: 3863131
NCBI-ProteinID: XP_953129
GeneDB: TA08590
UniProt: Q4U9J9
Position
4
AA seq 329 aa AA seqDB search
MEGNESISSLSMSKLVIGVNHLHNTSMRSNHIFIHWLNYLINQSYPYENWIIYGSSNNGV
LTLQRKLLRCLIKRFIIFYLKYIKRKWLGGNWKCNGTKQSISDLLLHFNRHQTKNNNLDV
VLFPPSLYVEHTRNELKSEVFELGVQNVSQSKSGAFTGELSLTMFTDFGLKWSLVGHSER
RQLFNEDDSYVCEKVMMLQENGVNAVVCFGETLSEREQGQTENVLKRQLDAFVKHVKDWD
KVVLAYEPVWAIGTGKVATVDQVKEAHKFVRDYVRGLVGDVADKVRLVYGGSVNEKNCLE
LSKCSDVDGFLVGGASLKKEFLDILKSLE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaatgagtctatctctagcctcagtatgagtaagctggtaattggtgtgaac
catttacataacacatctatgagatctaaccatatttttattcattggttaaattatttg
ataaatcaaagttatccatatgaaaattggataatttatggatcttcaaataatggtgta
cttacactccaacggaagttgttgagatgtttaataaaaagattcattatattttacttg
aaatatataaaaagaaagtggttaggcgggaattggaaatgcaatggaactaagcaatcc
atatccgatcttttattacattttaatagacatcaaacgaaaaacaacaatttagatgtc
gtactatttccaccttctctttatgtcgaacatactagaaatgaattgaagagtgaagtt
tttgaacttggcgtccagaatgtttctcagtctaaatctggagccttcactggagaattg
agcttaactatgtttacagatttcggcctaaaatggtcacttgttggtcactctgagcgt
agacagctctttaacgaggacgactcttacgtgtgtgaaaaagttatgatgttacaagaa
aacggtgtaaatgcagtagtttgctttggcgaaacattgtctgaacgcgaacaaggccag
acagagaatgtccttaagagacaacttgatgcctttgtaaaacatgtaaaggactgggac
aaagtagtattagcctatgaacctgtttgggcaatcggcactggtaaagttgcaactgtt
gaccaggttaaagaggcacacaagtttgtgagggattatgtgaggggattagttggagat
gttgccgacaaggtccgactagtttatggagggtcggtgaacgagaaaaattgccttgaa
ctttcaaagtgcagtgatgttgacggatttctagttgggggtgcttcgctcaagaaggaa
tttttggatattctgaaatcactagaataa

DBGET integrated database retrieval system