KEGG   Theileria annulata: TA10380Help
Entry
TA10380           CDS       T00253                                 

Definition
(RefSeq) cyctochrome C, putative
  KO
K08738  cytochrome c
Organism
tan  Theileria annulata
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrom_C1 eIF2A
Motif
Other DBs
NCBI-GeneID: 3862553
NCBI-ProteinID: XP_953349
GeneDB: TA10380
UniProt: Q4U8X9
Position
4
AA seq 155 aa AA seqDB search
MSTSDDWNDIPDDFVLPEGSAERGAKLFKKHCKQCHSMRPDNRQTGGFSSIGPTLFNVYG
RTSGIQNLGGLNLMTHSMKSSGIVWDDANLMRFDFKAIKTFRYMKNPQLFVNSKIGMNFV
GLPRFQDRVDVVHFLRQLNYEGKYGKEVLKECEKK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcagatgactggaatgatattccggatgatttcgtactcccggaaggctca
gcagaaagaggagcaaagctctttaaaaaacattgcaagcaatgtcattccatgagacca
gataatcgccaaacaggaggatttagctcaattggtccaactttatttaatgtttatggc
cgcacttcaggaatccagaacctaggaggactcaacttgatgacccattcaatgaagtca
tctggaatagtgtgggatgacgcaaacttgatgaggtttgattttaaggcaattaaaaca
tttaggtacatgaaaaacccacaactgttcgtaaatagcaaaattggaatgaattttgtc
ggacttccaaggttccaggaccgcgtggatgttgtacacttccttcgccagcttaactac
gaaggaaagtatggaaaagaagtgctaaaagaatgcgagaagaaatga

DBGET integrated database retrieval system