KEGG   Theileria annulata: TA12705Help
Entry
TA12705           CDS       T00253                                 

Definition
(RefSeq) hypothetical protein, conserved
Organism
tan  Theileria annulata
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_8 Thioredoxin_2 OST3_OST6 KaiB
Motif
Other DBs
NCBI-GeneID: 3862282
NCBI-ProteinID: XP_952366
GeneDB: TA12705
UniProt: Q4UE55
Position
2
AA seq 411 aa AA seqDB search
MAWPTRIPVIHIFVILFSSINLTLARQYVDPMQHDLQVVNSKTFTTNVQLARQTNVVGAF
FYSTGDTNLTSTINELNSVAKDLKGMITIVAVNCTDQSLKNLCKSELGEEYLTPAFKIYP
KLPMPAFDFKKELLKEDVKKELLKHLPSNVERVEVGMLAHFMTKHELMPKVLLFSDKEHP
SYVYKALSNAFNKKLLLGFVDANKHPDLKKEYGVKSLPTMLVIKPNGKPQKYKGEFKYLP
MFEWLNVNAEAFLLGGGYSDKGDPAKAKPWKFDKVPKLNFFSHKDICFNKTQGLCIIYLT
DSDLKPEEKEMLVHLSEKYTGQITGKWMWMNLNEETEFAQLFENVKVLPSAVVFNPKKRL
RYFLHDGNTSVTKSSMERMLEKILGGDARFTLVNGELPKFKIDDLLTTEEL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggccaacgaggattcctgtcattcatatatttgtcatattgttttcatctatt
aatctaacactagccagacaatatgtcgacccaatgcaacatgatttgcaagttgtaaat
tcaaaaacattcacaacgaacgtacaattggctcgccaaacaaatgtagtaggagcgttt
ttctattcaacaggagataccaacctcacctcaacgataaatgagttgaactcagtagca
aaagatctcaaagggatgattacaatcgtcgcagttaactgtacagaccagtcacttaag
aacctatgtaaaagtgaacttggagaagagtatttgacgccagcgttcaagatctatcca
aagttacctatgccagcatttgatttcaagaaagaattgttgaaagaagatgtgaagaag
gaacttttaaagcacctcccatcaaatgtggagagggtggaggttggaatgttggctcat
ttcatgacaaagcacgaattgatgccaaaggtgctgttattttctgacaaggagcatcct
tcgtatgtctacaaggcacttagcaacgctttcaacaaaaaactgttactgggattcgtt
gacgcgaacaaacacccggatctaaagaaggaatacggtgttaagagcctgccaacaatg
ttggtaattaaaccaaatggaaagccgcaaaagtataaaggagagttcaagtaccttcca
atgttcgagtggctaaatgtaaacgcagaagcgttcctacttggaggagggtattctgat
aaaggagatccagcaaaagcaaaaccatggaaatttgataaggtaccaaagttgaatttc
ttctcccataaagatatctgttttaataaaactcagggactgtgcatcatttatcttact
gattctgatttgaaaccagaagagaaggaaatgctggtccatttaagcgaaaagtacact
ggacaaattacgggaaagtggatgtggatgaacctgaatgaagagaccgagtttgcacaa
ctgttcgaaaatgtaaaggtattgccatcagcagtggtatttaacccgaagaagagactg
aggtacttcttacatgacggaaatacgtcagtaacaaaaagctcaatggaaagaatgttg
gaaaaaatactagggggagatgctagattcacactagtaaacggagaactccccaaattc
aagatagacgaccttttaaccacagaagaattgtaa

DBGET integrated database retrieval system