KEGG   Thiomicrospira aerophila: THIAE_02015Help
Entry
THIAE_02015       CDS       T03589                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
tao  Thiomicrospira aerophila
Pathway
tao00450  Selenocompound metabolism
tao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tao00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    THIAE_02015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tao03016]
    THIAE_02015
Enzymes [BR:tao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     THIAE_02015
Transfer RNA biogenesis [BR:tao03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    THIAE_02015
 Prokaryotic Type
    THIAE_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AHF00705
UniProt: W0DQ45
Position
407460..408503
Genome map
AA seq 347 aa AA seqDB search
MDVLLTQYSHGAGCGCKISPSQLNIILAGAQSSVNFPGLVVGHGAKDDAAAFDLGDGRVV
LSTTDFFMPIVDDPHTFGRIAATNALSDIYAMGGQPLMAIAILGWPMDKLSPEIAAEVIA
GGRQVCEQAGIPLAGGHSIDAPEPIFGLAVTGIANQSNLKTNRMAQAGCDIFLTKPLGVG
ILTTAQKQQTITAADLTHAISSMCQLNAIGARLADFDGVTCITDVTGFGLLGHLLEVCEA
SGIRARLDVNAIPLLPNVIAYLEQGCVPGGTLRNWHSVQDKVVPLDEQTQRLLCDPQTSG
GLLVMVKQSARIAFQALCQQQGVDLQPIGQTFKSALNQPNAPIIEVV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctattaacgcaatatagtcatggtgccggctgtggttgtaagatttcgcca
agtcagctcaatattattttggccggtgcgcaatccagtgttaactttccaggcctggta
gtcggccatggcgcgaaggacgatgcggccgcgtttgatcttggcgatggccgagtggtg
ttatcgaccaccgatttttttatgcccatcgtggatgatccacatacgtttgggcgtatt
gctgcgactaatgcgctgtcagatatttatgcgatgggtgggcagcccctaatggcaatt
gcgattctcggttggccaatggataagctcagtccagagattgccgccgaggtgattgcc
ggtggccgccaagtgtgtgagcaagccggtattccgctagcgggtgggcattctattgat
gcgccggagccgatttttggtttagcggtgactggtatagccaaccaatctaacttaaaa
accaatcgcatggcacaagcgggctgtgatatttttctgactaagccgttgggtgtgggt
attttaactactgcgcaaaagcaacaaacaatcaccgcagctgacttaacccatgccatc
agtagtatgtgtcagttaaatgctatcggggcgcgtttagccgattttgatggggtgacc
tgtattaccgatgtgaccgggtttggcttgttaggacatttgttagaggtttgcgaggca
agtggtattcgagcgcgtttagatgtcaacgcaattcctctattaccaaatgttatcgcc
tatttagagcagggttgcgtaccgggtggcacgctgcgtaattggcacagtgttcaagac
aaggttgtgcccttggatgagcagacgcagcgtttattgtgtgatccgcaaacatcgggt
ggattgctagtgatggtcaaacaaagcgcgcgaattgcgtttcaggccttgtgccagcaa
cagggtgtggatttacagccgattggacagaccttcaaatctgcgttaaatcagcccaat
gcgccgattattgaggttgtgtaa

DBGET integrated database retrieval system