KEGG   Thiomicrospira aerophila: THIAE_04075Help
Entry
THIAE_04075       CDS       T03589                                 

Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
tao  Thiomicrospira aerophila
Pathway
tao00540  Lipopolysaccharide biosynthesis
tao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tao00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    THIAE_04075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tao01003]
    THIAE_04075
   01005 Lipopolysaccharide biosynthesis proteins [BR:tao01005]
    THIAE_04075
Enzymes [BR:tao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     THIAE_04075
Glycosyltransferases [BR:tao01003]
 Polysaccharide
  Bacterial polysaccharide
   THIAE_04075
Lipopolysaccharide biosynthesis proteins [BR:tao01005]
 Lipid A
  THIAE_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AHF01081
UniProt: W0DW21
Position
852553..853755
Genome map
AA seq 400 aa AA seqDB search
MALSVSSRSTDQPVFALVAGELSGDTLGADLMQGLLARHPNARFVGIGGPKMQALGLESW
ADMSQLSIMGFAEVIKHLPKLLKLRAQLAAQIIALKPDAFIGIDAPDFNLGLAKKLKQAG
LVTVHYVSPSIWAWRPKRIHKIKASVSGMLVLFPFEEALYQQQQIPVACVGHPLAKQVPN
DPDDVSQIHAAKASLGMSDDQPIMAVLPGSRLSEVTTMAPIYLDTLLKLHPRFPAYQFVI
PCVNQRIYELLADMLAQQAPGLPISLVQMPAQPVLQASDLVLVTSGTATLETALMARPMI
IAIKVHPVSYWIMKRMALLSWVGLPNILAQQTIVPEFIQDEARADKLALALGQLLVDEQA
RASQRRAFYQLKDTLTRESGQLAAQAVCEWAGLATPVERA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggcattatccgttagcagtaggtcaaccgatcagcccgtttttgcactagtagccggt
gagctgtcaggcgatacattgggcgctgatttgatgcagggattgctcgctcgccatcca
aatgctcgttttgtgggtattggtggcccgaaaatgcaagcactaggtttggaaagctgg
gcggatatgagtcagctatcaattatggggtttgccgaggtaatcaagcatctgcccaaa
ttactaaaactgcgtgctcagcttgcagcacaaattattgcactcaaaccagatgcgttt
ataggcatagatgcgcctgattttaatttaggcttggctaaaaaactcaaacaagcaggc
ctggtgacggttcattacgttagcccgtctatttgggcatggcgtcccaaacgtatccat
aagattaaagcttcggtatccggcatgttggtgctgtttccgtttgaagaggcactctat
cagcaacagcaaattccggtggcctgtgtaggtcatccgttagcaaaacaagtgccgaat
gatccggatgatgtcagtcagattcacgctgcaaaagcatcactcggtatgtcggacgat
caaccaatcatggcggtgttgccgggttcgcgattgagtgaagtcaccaccatggcgccg
atctatttggatacgcttttaaagttacatccgcgttttccggcctatcagtttgttatc
ccctgcgtcaatcagcggatttatgagttattggccgacatgctagcgcagcaagcacca
ggtctgccgatcagcttagtgcaaatgcctgcgcaacctgtgctgcaagccagcgatctc
gtgctcgttacctccggtacggcaacccttgaaacggccttaatggccagaccgatgatc
atagcgattaaagttcacccagtatcttactggattatgaagcggatggccttattgtcc
tgggtcggcttgccgaatattctagcgcaacaaacgatcgtgcctgagtttattcaggat
gaggcgcgtgccgacaaattggccttagctttggggcaattgttggtcgatgagcaagct
cgcgcatcacaacgacgtgcgttttatcaacttaaagacacgctcactcgtgagtctggt
cagctagcggcgcaagctgtttgtgaatgggctgggctggctacccctgtcgagagggcg
taa

DBGET integrated database retrieval system