KEGG   Thiomicrospira aerophila: THIAE_05195Help
Entry
THIAE_05195       CDS       T03589                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tao  Thiomicrospira aerophila
Pathway
tao00030  Pentose phosphate pathway
tao00480  Glutathione metabolism
tao01100  Metabolic pathways
tao01110  Biosynthesis of secondary metabolites
tao01120  Microbial metabolism in diverse environments
tao01130  Biosynthesis of antibiotics
tao01200  Carbon metabolism
Module
tao_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THIAE_05195
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    THIAE_05195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tao04147]
    THIAE_05195
Enzymes [BR:tao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     THIAE_05195
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     THIAE_05195
Exosome [BR:tao04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   THIAE_05195
  Exosomal proteins of colorectal cancer cells
   THIAE_05195
  Exosomal proteins of bladder cancer cells
   THIAE_05195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Proton_antipo_C
Motif
Other DBs
NCBI-ProteinID: AHF01268
UniProt: W0DVH3
Position
complement(1062864..1064354)
Genome map
AA seq 496 aa AA seqDB search
MPVSCTYVIFGATGNLSLTKLFPAFYHLEVLGRLDPGVKIVALGRRDWQRNDWIEQAKQA
VLPVARKGLDNAVFERFSARLDYIKVDINEPQSFCEMAAYFEQHDYPKNMAFYLSISPKE
FNPVVQHLAKAQLLDERDGWRRVVFEKPFGYDLESAKSLQTQLNRCLDEKQMYRIDHYLG
KGMVQNLMVFRFANLLMEPLWNRNYIDHVQITHAEAKPIGTRAGYYDGSGALRDMIQSHL
LQLLAIIAMEPPASIEAEDLRNEKVKLLKSIRPIAKSAVNAQAYRAQYAAGKVNGKSMPA
YLDEPGVAPDSVTETYAALKLYIENWRWAGVPFYVQTGKNMPKNQTIISICFKHPPKQFF
RESQVKKMAPNWLVFGIQPEETIRIEMTAKQPGLEINTRQVSLDASMRQEDEEQHDAYEE
LLLDVIKGDRSLFLRFDEVKAAWKVVEPVLQAWSSDRGYIDTYASGTWGPRDANKLFDQP
GQQWRVNLEPEEGTDA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccggtttcctgtacctatgtgatttttggtgccaccggcaacctgtcattaaccaag
ttattcccggctttttatcatttagaagtgctagggcgcttagacccaggtgtgaaaatt
gtggcattagggcgtcgtgattggcaacgcaatgattggattgagcaagctaagcaggcg
gtattgcctgttgcgcgcaaaggtctagataatgcggtgtttgaacgctttagtgcccgt
ttagactacatcaaggtcgatatcaacgaaccgcagtctttttgtgagatggccgcctat
tttgagcagcacgactacccaaaaaacatggcgttttatttatcgatcagcccgaaagaa
tttaacccagtggtgcagcatcttgcgaaggcgcaattactggatgagcgtgatggttgg
cgacgcgtggtgtttgaaaaaccctttggctatgatctagaaagtgctaagagcttgcaa
acccagctcaatcgttgcctagatgaaaaacagatgtatcgcattgaccattatctaggc
aagggcatggtgcaaaacctgatggtgttccgctttgccaacctgttgatggaacccttg
tggaatcgcaattacattgatcatgtacaaattacccatgctgaggccaagccaattggc
actcgtgctggctattatgatggcagcggtgcgttgcgcgatatgattcaaagtcatcta
ttgcaactgctcgctattattgccatggagccaccggcctcgattgaagctgaggatttg
cgcaacgaaaaagtgaaacttcttaaatccattcgacctattgctaaatcggcggttaat
gcccaagcttatcgtgctcaatatgcggcaggaaaagtgaatggcaagtcgatgccggct
tatttagacgagcctggggtagcacccgacagcgtgacggaaacttatgcagccctgaaa
ctatacattgaaaactggcgttgggcaggcgtgccgttttatgttcaaaccggcaaaaac
atgcctaaaaaccagacgattatttcgatttgttttaagcatccccctaagcaatttttt
cgtgaatcccaggtgaaaaaaatggcgcctaactggttggtgtttgggattcagccggaa
gagaccattcgaattgaaatgaccgctaaacaaccggggttagagattaatacccgccaa
gtgtcgctcgatgccagtatgcgtcaagaagatgaagagcaacatgatgcctatgaagaa
ttgttgcttgatgtcattaaaggtgaccgctcattatttttacgctttgatgaagtaaag
gcggcttggaaggtggtcgagccggtcttgcaggcctggtcatcggatcgtggctatatt
gatacctatgcttcaggcacatgggggccgcgtgatgctaataagctgtttgatcagccg
ggtcagcagtggcgggttaatttggaacctgaggagggtacggatgcctaa

DBGET integrated database retrieval system