KEGG   Terribacillus goriensis: GZ22_00975Help
Entry
GZ22_00975        CDS       T03216                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
tap  Terribacillus goriensis
Pathway
tap00030  Pentose phosphate pathway
tap01100  Metabolic pathways
tap01120  Microbial metabolism in diverse environments
tap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GZ22_00975
Enzymes [BR:tap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     GZ22_00975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF1776 THF_DHG_CYH_C 2-Hacid_dh_C Glyco_tran_WecB QRPTase_C DNTTIP1_dimer
Motif
Other DBs
NCBI-ProteinID: AIF65368
UniProt: A0A075LLQ2
Position
189258..190031
Genome map
AA seq 257 aa AA seqDB search
MYDDLRGKTAIVTGSSKGIGRAVAERFGQEGMNVIVNYHGDEDGANQAAENIRQAGGKAI
VIQADVSKKEEVQKLLDAALSEFGGLDVMVNNSGFGKPEPFHEMKEETWRSVIDVNLTGT
FLGGQVALRHMLENNIKGSIINMSSVHQQIPKPSDSHYAASKGGIKLLTETMALEYAANG
IRVNAIAPGTIDTERNEDTKPENEAKQMKKIPMQSFGKPEEIAAAAAWLASKEASYVTGT
TLFVDGGMTLYPSQLEL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgatttaagaggaaagacagctatcgtcactggttcttccaaaggaataggt
cgtgcagttgcagaacgattcggacaagagggcatgaatgttatcgttaattatcatggg
gacgaggatggagctaatcaagcggccgagaatatccgccaagctggcgggaaagcaatt
gtcattcaagcagatgtttccaagaaagaagaggttcagaaactgctggatgcagctctt
agcgaattcggtgggttggatgtgatggtaaataactctggattcggtaaaccggagcca
ttccacgaaatgaaagaggaaacgtggagaagtgtgattgatgtaaacttgacaggaact
ttcctcggcggccaagtggctttgcgtcatatgctggagaataatataaaaggcagcatt
atcaatatgtctagtgtacaccagcaaattccgaaaccttctgatagtcattacgctgca
tcgaagggcggtattaagttattaactgaaacaatggcactcgagtatgcggctaacgga
atcagagtaaacgccattgcaccaggaacaattgatacggagcggaacgaagataccaaa
ccggaaaacgaagcaaagcagatgaagaagataccgatgcaatccttcggtaagccagaa
gagattgcagcagctgctgcatggcttgcatctaaggaagcaagctacgtcacaggtact
acacttttcgtcgatggcggtatgacgttgtacccttctcagttagaactgtaa

DBGET integrated database retrieval system