KEGG   Terribacillus goriensis: GZ22_04225Help
Entry
GZ22_04225        CDS       T03216                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
tap  Terribacillus goriensis
Pathway
tap00620  Pyruvate metabolism
tap00630  Glyoxylate and dicarboxylate metabolism
tap01100  Metabolic pathways
tap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GZ22_04225
   00630 Glyoxylate and dicarboxylate metabolism
    GZ22_04225
Enzymes [BR:tap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     GZ22_04225
    1.2.1.22  lactaldehyde dehydrogenase
     GZ22_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AIF65917
UniProt: A0A075LJ10
Position
777475..778935
Genome map
AA seq 486 aa AA seqDB search
MEITTKKYQMFIDGEFVNSSSQETLDVVNPATEEIISEIPRGTIGDVRAAIDSAKRAQKK
WKKTPAFERGNYLLEISKEIRKNEDVLARTISEEMGKTLALARTEVNFTADYIDYMAGWA
RRYEGEIVQSDRPNEQIFVHKEPIGVIAGILPWNFPFFLVARKAAPALVTGNTIVLKPSD
LSPNNALEFAKIIEKVGLPKGVINIVTGSGRTIGQEMAKHEDIGMVSLTGSYNAGAAVMR
AAAENITKVSLELGGKAPAIVMDDADIDLAVRSVIDSRIINTGQVCNCTERVYVHESIAE
EFISKVTKAMSEVRYGDPLVDGDIDMGPLISKDALESVDQMVQEAVADGAKLVTGGKPSA
REKGYFYEPTVLVNVNNEMNIMQQEIFGPVLPIATFKDLDDALKLANDCEFGLTSSIYTQ
NLDVTMRASKELEFGETYVNRENFEAIQGFHAGWKKSGIGGADGKHGLDEYLQTHVVYLQ
YNQEKK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaaattactactaagaagtatcaaatgttcattgatggagaatttgtaaactctagt
tcccaggaaacactcgatgttgtgaatcctgcaaccgaggaaattatttcagagattcct
cgaggaactataggagatgtaagagcagcaattgactctgctaagcgtgctcaaaaaaaa
tggaagaaaactcccgcttttgaaagaggaaattacttattagagatctccaaagaaata
cgcaaaaatgaagatgttttagcacgtaccatttcagaggaaatgggaaaaacactggcc
ttagctagaacagaggtaaactttacagccgattacattgattatatggctggatgggcg
agacgctatgaaggtgagattgttcaaagtgatcgtcctaatgaacaaatatttgttcat
aaagaaccgattggggttatcgctggtatcttaccatggaatttcccatttttcctggtt
gctcgtaaagcagctcctgctttggtcacagggaatacaattgttttgaagccaagtgat
ttatctcctaataatgctttagagtttgcaaagattatagaaaaggttggtttgcctaaa
ggcgttattaatatcgtgaccggcagcggtcgtacaattggtcaggaaatggcgaaacat
gaagatatagggatggtcagcttaacgggaagttataatgctggagctgccgttatgcgc
gctgctgcagaaaatatcacaaaggtatctttggaattgggaggaaaagctcctgctatt
gttatggatgatgctgatattgatttggcggtacgttccgttatcgattctcgtatcatt
aacacagggcaagtatgtaactgtacagagcgtgtatatgttcatgaaagcatcgcagaa
gagtttatctccaaagtaacaaaagcaatgtcagaagtaagatatggtgaccctttagtt
gatggagatattgatatgggtcctcttattagtaaagatgcgcttgaatctgtagaccaa
atggttcaagaagcagtggctgacggtgcaaagctagtgacaggtggtaagccttctgcg
agagagaaaggttatttctatgaaccaactgttcttgtaaatgtaaataatgagatgaat
atcatgcagcaagaaatctttggtccagttcttccaattgccacatttaaagatttagac
gatgctcttaaactggcaaatgattgtgagttcgggctaacgtcttctatctatacacaa
aacctggatgtaacaatgcgtgcaagcaaggaattggaatttggcgaaacatatgttaat
cgtgaaaactttgaagcaatacaaggctttcatgctggatggaaaaagtccggtatcggc
ggtgctgatggaaaacacgggttagatgagtatctgcaaacacatgttgtgtatcttcaa
tataaccaagaaaagaaataa

DBGET integrated database retrieval system