KEGG   Terribacillus goriensis: GZ22_04610Help
Entry
GZ22_04610        CDS       T03216                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tap  Terribacillus goriensis
Pathway
tap00260  Glycine, serine and threonine metabolism
tap01100  Metabolic pathways
tap01110  Biosynthesis of secondary metabolites
tap01120  Microbial metabolism in diverse environments
tap01130  Biosynthesis of antibiotics
tap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GZ22_04610
Enzymes [BR:tap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     GZ22_04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIF65984
UniProt: A0A075LHT8
Position
complement(862146..863177)
Genome map
AA seq 343 aa AA seqDB search
MIDLRSDTVTKPSEAMRKAAYEAEVGDDVYGEDPAVNELEETVADLLGKEAALFVPSGTQ
GNQIAVLSHCNPGNEIILEEESHIFLYEGAATSIFAGVQTRTLKGQRGAICPEGLAAAIR
KDDIHFPETGLICLENTHNKAGGAVIPIENMMVIAQIAREHRIPIHLDGARLFNASAASG
ISVAKYAQLTDTVQVCLSKGLGAPVGSVLAGSKVFIDKARKWRKRLGGGMRQAGILAAPG
LVALRENVERLADDHENAKLLADGLAEIDGIEIMNKVETNIVLADVQGTGVTADAYVQLL
KEQQVLANAFGPYSVRFVTHYDVGKGAIKKALAVASSLSKQPN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgcgtagcgatacggtcaccaaaccatcagaagcgatgcgaaaagctgct
tatgaagcagaggtcggagatgatgtctatggagaagatccagctgttaatgagctagag
gaaacggttgccgatttacttggaaaggaagccgcattattcgtaccaagcggtactcag
gggaatcaaatcgcagtactatctcattgcaaccctggtaatgaaattatacttgaagag
gaatcgcatattttcctctatgaaggagctgctacatccatttttgctggtgtacagaca
cgtactctgaaaggtcaacgcggtgcaatatgtccggagggattagctgctgctattcgc
aaggacgatattcattttccggaaacaggcttgatttgtttggaaaatacgcataacaaa
gcaggcggagctgtcattccaattgaaaatatgatggtaattgctcaaatagcacgcgag
caccgaattccgattcatttagatggtgcacgtttgttcaatgcctctgctgcttccggt
attagtgtagcaaaatatgcgcagctaactgatactgtccaggtttgtttatccaaaggc
ttaggagcacctgtcggttctgttctggcaggatctaaagtgttcatcgataaagccaga
aaatggagaaagcgtcttgggggcggcatgcgccaagcaggcatattggcagcacctggt
cttgttgctctgcgtgaaaatgtagagcgccttgcagatgatcatgaaaatgcgaagcta
ttggcagatggccttgctgagattgacggtattgaaataatgaataaagtcgaaacgaat
attgtacttgcagatgtgcaaggtactggtgtgacagctgatgcatatgttcagctgctt
aaagaacagcaagtattagctaatgctttcggcccttatagcgttcgttttgtaacacat
tatgatgttggtaaaggtgcaataaagaaagctttggcagttgcttcatcactttcgaaa
cagccaaattga

DBGET integrated database retrieval system