KEGG   Terribacillus goriensis: GZ22_07690Help
Entry
GZ22_07690        CDS       T03216                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tap  Terribacillus goriensis
Pathway
tap00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GZ22_07690
Enzymes [BR:tap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     GZ22_07690
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     GZ22_07690
    1.1.1.-  
     GZ22_07690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C F420_oxidored ADH_N_assoc Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AIF66528
UniProt: A0A075LPW9
Position
1462015..1463031
Genome map
AA seq 338 aa AA seqDB search
MKSLVYYGSKNVKVENITEPEVSKDTVKVKVKFAGICGTDLHEYLHKTFVTEDKMILGHE
FTGEIVEVGDNVTKFKAGDRVAVEPIWGCGECDTCKTGNYNICPDMKSYGIHENGGFAEY
VVVKEANVFTLPDTLSYELAALVEPLAVVLQAIRKSKFKIGDSVALFGAGPIGLLLSESL
RAAGASKIFVAEVSEERRELALKMGADIVINPAEEDAVQIIKDNTNGGVDVSFDVAGVEA
TFNQSLDCIKPNGEFMIVSVFANPVNYHPTMQVVSEKKINSSLGYNNIFAQAIDLLAKGS
LNVEPVITSIIALDNIVEDGFEKLIGDKNECKILVRPS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctttagtatattacggatcgaaaaacgtaaaggttgaaaatattactgaacca
gaagtgtccaaggatacggttaaagtaaaagttaagttcgcaggtatatgcggtactgat
ttacatgaatacctacataagacctttgtaacagaagataaaatgattttaggtcatgag
tttacaggtgaaattgttgaagtgggtgacaatgtaacgaaatttaaagctggtgacaga
gtagccgttgaacctatttggggatgtggcgagtgtgatacctgcaaaacaggaaactat
aatatatgtcctgatatgaaatcatacggaattcatgagaatggtggatttgcggaatac
gttgtagtaaaagaagcgaatgtgtttacactacctgatacactcagctatgaattggca
gctttagtagaaccactcgctgttgtgttgcaggcaatcagaaaaagcaaatttaaaatt
ggagacagtgtcgctctctttggtgcaggaccgattggattgctattatcagagagtttg
agagcagcaggagcaagtaaaatttttgttgctgaagttagtgaagaacgcagggaatta
gcattgaaaatgggtgcagacatagtaataaatccagcagaagaagatgctgttcaaatt
attaaagataatacaaatggcggtgtggacgtttcatttgatgttgccggagtggaagct
accttcaatcaatctcttgattgcataaaacctaatggggaattcatgattgtcagtgtc
tttgccaatccagttaactatcaccctacaatgcaagtagtcagtgagaaaaaaatcaat
tcttcactcggttacaataatatctttgcccaagcaattgatttgttagcaaaaggatca
ttgaatgttgaaccagttattactagtattatagcgttagataacattgtggaagacggg
tttgaaaaactaataggggataaaaatgaatgtaaaattttagttcgtccgagctaa

DBGET integrated database retrieval system